Forum du Peuple

Forum => Actualité et Société => Discussion démarrée par: sharl le avril 01, 2021, 10:47:30 am

Titre: Le vaccin et vous
Posté par: sharl le avril 01, 2021, 10:47:30 am
Vais probablement y aller, mais pas encore décidé. Si j'y vais, ce sera à reculons et sans conviction.

J'ai l'impression que le vaccin qui sera donné va très bientôt être dépassé par les nouveaux variants. Pas question d'avoir trois vaccins en 1 an: 1ere dose, 2e dose, puis un troisième vaccin d'ici un an contre les nouveaux variants.

 
Titre: Le vaccin et vous
Posté par: Snookey le avril 01, 2021, 11:12:06 am
T'es l'un des premiers à chialer sur les mesures, mais tu sais pas si tu veux te faire vacciner...

Parle-moi de ça quelqu'un qui est sans conviction.
Titre: Le vaccin et vous
Posté par: MadChuck le avril 01, 2021, 01:48:31 pm
Pas question d'avoir trois vaccins en 1 an: 1ere dose, 2e dose, puis un troisième vaccin d'ici un an contre les nouveaux variants.

Je suis curieux pour des raisons de ?

Avec les technologies de vaccin qui se font en moins de 72 heures, ça risque d'être une bonne idée, surtout si ils peuvent être pris sans chaîne de froid compliqué en simple comprimé.

Un nouveau née moyen a quoi 12 vaccin en 18 mois ?

Seulement pour des raisons de déplacement sur place et recevoir le vaccin, ou il y a plus ?
Titre: Le vaccin et vous
Posté par: dalporto le avril 01, 2021, 01:50:46 pm
Quand je suis parti en afrique, ils m'en ont fait genre 7 en 5 minutes.  C'est quoi le problème le grand voyageur?
Titre: Le vaccin et vous
Posté par: Ring0 le avril 01, 2021, 02:14:59 pm
Les vaccins à ARNm comme le Pfizer et le Moderna semblent être super efficaces, même contre les variants. Donc une fois vacciné, en théorie pas besoin de nouvelles doses annuelles.

Les autres vaccins comme le AstraZenaca et le J&J semblent avoir plus de difficultés avec les variants, mais ils réduisent quand même considérablement les hospitalisations.
Titre: Le vaccin et vous
Posté par: sharl le avril 01, 2021, 04:14:54 pm
Pas question d'avoir trois vaccins en 1 an: 1ere dose, 2e dose, puis un troisième vaccin d'ici un an contre les nouveaux variants.
Je suis curieux pour des raisons de ?

D'abord, je n'ai pas vraiment confiance en ces vaccins. Ce serait comme se faire vacciner pour se faire vacciner,,,

Un mélange de foi & d'espérance, de mouvement de masse et de crainte d'être stigmatisé si on n'y va pas 

Dans le doute, abstiens-toi. Sur un plan individualiste, le choix rationnel est d'attendre tranquillement la seconde génération pendant que les autres se font vacciner et développent possiblement une certaine immunité collective.

Puis, j'ai maintenant  une peur bleu de l'aiguille. Au point d'injection, pas de gras, un tout petit filet de muscle qu'il faut bien pincer pour voir. Pas de doute! Ils vont me planter l'aiguille dans l'os ou un nerf,,, En plus, ils utilisent des aiguilles de 6-7 cm, ils font ça à la chaîne et on risque de tomber sur un boucher. J'aimerais me convaincre que c'est irrationnel, mais ça ne l'est pas.

Quand je suis parti en afrique, ils m'en ont fait genre 7 en 5 minutes.  C'est quoi le problème le grand voyageur?

Le pire, c'est le choléra qui n'était bon que pour 6 mois. Un bout, j'avais deux passeports brochés ensemble et deux carnets de vaccination brochés ensemble,,,

Le mieux, ça été une campagne de vaccination au pistolet contre l'encéphalite japonaise. Je pense que le type au pistolet en vaccinait un à la seconde. Je me souviens encore de la poussière (sable), de l'ambiance et on ne devait être que 3-4 expats Blancs dans cette masse Noire.

 
Titre: Le vaccin et vous
Posté par: Snookey le avril 01, 2021, 04:38:23 pm
Pas question d'avoir trois vaccins en 1 an: 1ere dose, 2e dose, puis un troisième vaccin d'ici un an contre les nouveaux variants.
Je suis curieux pour des raisons de ?

D'abord, je n'ai pas vraiment confiance en ces vaccins. Ce serait comme se faire vacciner pour se faire vacciner,,,

Un mélange de foi & d'espérance, de mouvement de masse et de crainte d'être stigmatisé si on n'y va pas 

Dans le doute, abstiens-toi. Sur un plan individualiste, le choix rationnel est d'attendre tranquillement la seconde génération pendant que les autres se font vacciner et développent possiblement une certaine immunité collective.

Puis, j'ai maintenant  une peur bleu de l'aiguille. Au point d'injection, pas de gras, un tout petit filet de muscle qu'il faut bien pincer pour voir. Pas de doute! Ils vont me planter l'aiguille dans l'os ou un nerf,,, En plus, ils utilisent des aiguilles de 6-7 cm, ils font ça à la chaîne et on risque de tomber sur un boucher. J'aimerais me convaincre que c'est irrationnel, mais ça ne l'est pas.

 


Tu nous as habitué à écrire un paquet de niaiseries, mais là c'est un nouveau sommet.
Titre: Le vaccin et vous
Posté par: Enforcer le avril 02, 2021, 12:34:03 am
Il manque l'option "déjà fait" (du moins, en ce qui concerne la première dose). Je suppose que c'est l'avantage d'avoir fui en région éloignée et isolée il y a quelques mois; très peu de cas (aucun cas actif depuis la mi-janvier) et un accès plus rapide au vaccin (à ce jour, 80% des personnes de 18 ans et plus qui résident dans la région ont reçu au moins une dose).

Dans le doute, abstiens-toi. Sur un plan individualiste, le choix rationnel est d'attendre tranquillement la seconde génération pendant que les autres se font vacciner et développent possiblement une certaine immunité collective.

Par contre, si tout le monde t'imite et attend la deuxième génération en espérant que les autres se fassent vacciner et développent ce faisant une certaine immunité collective, il n'est pas nécessaire d'être très intelligent pour comprendre qu'il n'y aura pas d'immunité collective.

Ce qui m'amène à ceci: une des conditions nécessaires à la reprise d'une vie semblable à celle que nous menions avant le début de cette pandémie est que la majorité de la population soit vaccinée. Cependant, lorsque la pandémie sera derrière nous, tous les membres de notre société bénéficieront de l'allégement des mesures sanitaires qui en résulte, y compris les personnes qui n'auront pas été vaccinées, alors que ces dernières n'auront pas contribué à la construction de l'immunité collective qui nous permet cet allègement. Il s'agit donc là d'un excellent exemple du problème du passager clandestin (https://fr.wikipedia.org/wiki/Passager_clandestin_(%C3%A9conomie)); l'article Wikipédia qui explique ce concept et vers lequel j'ai fourni un lien mentionne d'ailleurs le refus de la vaccination comme exemple de ce problème.

Considérant cela, j'ai très peu de patience pour les gens qui sont en mesure de se faire vacciner et choisissent de ne pas le faire.

Puis, j'ai maintenant  une peur bleu de l'aiguille. Au point d'injection, pas de gras, un tout petit filet de muscle qu'il faut bien pincer pour voir. Pas de doute! Ils vont me planter l'aiguille dans l'os ou un nerf,,, En plus, ils utilisent des aiguilles de 6-7 cm, ils font ça à la chaîne et on risque de tomber sur un boucher. J'aimerais me convaincre que c'est irrationnel, mais ça ne l'est pas.

Je dois avouer que je ne suis pas friand des aiguilles non plus. Par contre, le site de vaccination où je suis allé n'utilisait certainement pas des aiguilles de 6 ou 7 cm. En fait, j'ai été agréablement surpris, car je m'attendais à ce que le processus soit beaucoup plus intrusif qu'il ne l'a été en réalité; la douleur est semblable à celle que l'on ressent lorsqu'on se gratte avec nos ongles au site de l'injection.

En ce qui concerne les effets secondaires, j'ai dû composer avec un peu de douleur au site de l'injection; cependant, cette douleur est comparable à celle que l'on ressent après avoir fait un effort musculaire lorsqu'on n'y est pas habitué, et a disparu complètement après quelques jours.

Addendum: Un nouveau cas actif dans la région aujourd'hui (2 avril 2020), le premier en deux mois et demi.
Titre: Le vaccin et vous
Posté par: Fouinard le avril 02, 2021, 09:39:04 am
J'ai été vacciné mercredi (Pfizer), seconde dose prévue le 21 juillet. Aucun effet secondaire, et concernant la piqure, je n'ai absolument rien senti.
Titre: Le vaccin et vous
Posté par: Wolfkiller le avril 02, 2021, 03:51:53 pm
T'as eu le meilleur, c'est cool.
Titre: Le vaccin et vous
Posté par: Lisa le avril 02, 2021, 08:48:02 pm
Le plus vieux du forum surtout ;)
Titre: Le vaccin et vous
Posté par: Wolfkiller le avril 02, 2021, 09:06:26 pm
Mes parents sont maintenant vaccinés! Pfizer baby!
Titre: Le vaccin et vous
Posté par: Lisa le avril 02, 2021, 09:11:23 pm
Moi ssi!
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 05, 2021, 10:38:45 pm
2 249 personnes aux USA sont décédé après avoir pris l'un des vaccins :
https://medalerts.org/vaersdb/findfield.php?TABLE=ON&GROUP1=AGE&EVENTS=ON&PERPAGE=100&VAX=COVID19&DIED=Yes

Bien évidement, je ne dis pas qu'ils sont tous mort a cause du vaccin. Ça serait imbécile comme dire que tout les morts avec un test positifs de covid en sont mort. Mais ça démontre, je pense, le genre de clientèle qui est vaccinée en priorité.

Titre: Le vaccin et vous
Posté par: Ring0 le avril 06, 2021, 09:57:16 am
Il y a 750 000 doses de vaccins en stock présentement au Québec.

On vaccine environs 41 000 personnes par jours. Ça fait 18 jours de stocks de vaccins en présumant aucune nouvelle livraison.

Ça serait le temps d'ouvrir la vaccination à tous afin de fonctionner à plein régime et administrer les doses à mesure qu'elles rentrent, pas les garder 2-3 semaines dans des entrepôts.
Titre: Le vaccin et vous
Posté par: Lisa le avril 06, 2021, 11:46:04 am
Messen,

Ou juste avoir une banque de noms, mettons que tu appelles en fin de matinée si trop de rendez-vous sont pas pris/manqués: on a 40 places en pm au stade, présente-toi si t'en veux un
Même un courriel automatisé.
Titre: Le vaccin et vous
Posté par: Ring0 le avril 06, 2021, 12:50:00 pm
Il commence à faire beau aussi. Ils pourraient établir certain site pour vacciner à l'auto comme aux États. Comme ça pas besoin d'être à l'intérieur avec plein d'autre monde. Ça réduit les risques pour tous.
Titre: Le vaccin et vous
Posté par: plsavaria le avril 06, 2021, 01:11:25 pm
Il commence à faire beau aussi. Ils pourraient établir certain site pour vacciner à l'auto comme aux États.

Ou comme au Canada.
Titre: Le vaccin et vous
Posté par: MadChuck le avril 06, 2021, 01:25:12 pm
2 249 personnes aux USA sont décédé après avoir pris l'un des vaccins :
https://medalerts.org/vaersdb/findfield.php?TABLE=ON&GROUP1=AGE&EVENTS=ON&PERPAGE=100&VAX=COVID19&DIED=Yes

Bien évidement, je ne dis pas qu'ils sont tous mort a cause du vaccin. Ça serait imbécile comme dire que tout les morts avec un test positifs de covid en sont mort. Mais ça démontre, je pense, le genre de clientèle qui est vaccinée en priorité.

Ça me semble virtuellement impossible que ce soit aussi bas que ça.

Il faut avoir tout un bon esprit statistique pour pouvoir commencer a y penser quelque chose sans prendre le temps d'y penser, considérant qui meurt environ en temps normal 40,000 personnes de 65 ans et plus par semaine aux États-unis, et qu'au moins 101 millions de personnes vacciné aux états-unis au moment ou vous aviez écrit ce message.

Il doit avoir plus de 2,200 personnes vaccinés qui meurt par jours aux états-unis (plus de 30% de la population a maintenant une dose, priorité aux personnes âgés et y'a en moyenne près de 8,000 morts par jours, vos donnée si-haut c'est seulement pour les premier vacciné en janvier ou avant on dirait.
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 06, 2021, 06:12:43 pm
Il doit avoir plus de 2,200 personnes vaccinés qui meurt par jours aux états-unis (plus de 30% de la population a maintenant une dose, priorité aux personnes âgés et y'a en moyenne près de 8,000 morts par jours, vos donnée si-haut c'est seulement pour les premier vacciné en janvier ou avant on dirait.
hahaha HAHAHAHAHAHAHAHA hahahahaha !!

Maintenant qu'on parle du vaccin, bien sur que 8 000 morts par jours c'est normal ! On va toujouras ben pas commencer a tirer des conclusion pour plus ou moins 10%.
Titre: Le vaccin et vous
Posté par: MadChuck le avril 06, 2021, 07:56:55 pm
Il doit avoir plus de 2,200 personnes vaccinés qui meurt par jours aux états-unis (plus de 30% de la population a maintenant une dose, priorité aux personnes âgés et y'a en moyenne près de 8,000 morts par jours, vos donnée si-haut c'est seulement pour les premier vacciné en janvier ou avant on dirait.
hahaha HAHAHAHAHAHAHAHA hahahahaha !!

Maintenant qu'on parle du vaccin, bien sur que 8 000 morts par jours c'est normal ! On va toujouras ben pas commencer a tirer des conclusion pour plus ou moins 10%.

je ne comprend pas votre message,
Attendez votre: 2 249 personnes aux USA sont décédé après avoir pris l'un des vaccins

N'était pas par jours, vous avez changé de sujet ? Quel 10% ? Esce que les vacciné meurt plus par 10% ?

Non, les vaccinés meurt moins que le reste de la population non vacciné dans toute les études.

10% de mort de plus que d'habitude pour le groupe dont on parle dans le pays dont on parlait, non:
20-21: 2,556,417
19-20: 2,073,318
18-19: 2,022,581
17-18: 2,042,725

C'est environ 25% de plus aux états-unis, et 10% de plus pour la population en général c'est normal.

7700-8000 par jours c'est normal, c'est pour ça que les semaine de plus de 11,000 morts par jours faisait peur.

Je ne comprend pas votre raisonnement que s'il y avait seulement 2,200 morts chez les vaccinées Américains ça indiquait le genre de population que l'on vaccinait, vouliez vous dire que les Américains vaccinait les jeunes sur de survivres pour donner des beau chiffres chez la population vacciné ?
Titre: Le vaccin et vous
Posté par: Snookey le avril 07, 2021, 02:30:01 pm
Au bureau, nous avons été déclarés comme étant service essentiel/prioritaire en mars 2020 par un sous-ministre de la Santé, lettre à l'appuie...

Je vais essayer de prendre rendez-vous vendredi et espérer que ça fonctionne !
Titre: Le vaccin et vous
Posté par: plsavaria le avril 07, 2021, 02:59:13 pm
Au bureau, nous avons été déclarés comme étant service essentiel/prioritaire en mars 2020 par un sous-ministre de la Santé, lettre à l'appuie...

Je vais essayer de prendre rendez-vous vendredi et espérer que ça fonctionne !

Pour cette vague de vaccination :
Font partie du groupe des travailleurs essentiels : le personnel scolaire des écoles primaires et secondaires, le personnel des garderies et des CPE, les pompiers, les policiers, les gardiens de prison, les travailleurs étrangers temporaires, les travailleurs d’abattoir, les travailleurs miniers en régions éloignées et les travailleurs du milieu communautaire.
Titre: Le vaccin et vous
Posté par: Lisa le avril 07, 2021, 03:04:56 pm
Ouiiiiiiii
Titre: Le vaccin et vous
Posté par: Snookey le avril 07, 2021, 03:29:00 pm
Au bureau, nous avons été déclarés comme étant service essentiel/prioritaire en mars 2020 par un sous-ministre de la Santé, lettre à l'appuie...

Je vais essayer de prendre rendez-vous vendredi et espérer que ça fonctionne !

Pour cette vague de vaccination :
Font partie du groupe des travailleurs essentiels : le personnel scolaire des écoles primaires et secondaires, le personnel des garderies et des CPE, les pompiers, les policiers, les gardiens de prison, les travailleurs étrangers temporaires, les travailleurs d’abattoir, les travailleurs miniers en régions éloignées et les travailleurs du milieu communautaire.


Je suis appelé à travailler avec des travailleurs de 5 de ces groupes, d'où le pourquoi nous avions été reconnus comme essentiels à l'époque, je me demande si cette liste est exhaustive !
Titre: Le vaccin et vous
Posté par: plsavaria le avril 07, 2021, 03:59:26 pm
Je suis appelé à travailler en contact prolongés, à distance réduite et en situation dynamique avec tous les groupes prioritaires (notamment aborigènes, situations de RCR, etc), et considéré service essentiel d'urgence.

Et je ne suis pas encore qualifié pour être vacciné au Manitoba / ne le serais qu'à partir de lundi au Québec.

La liste copiée plus haut semble exhaustive selon les publications actuelles de la santé publique.
Titre: Le vaccin et vous
Posté par: Wolfkiller le avril 07, 2021, 04:50:50 pm
Un gars de 40 ans de Québec, prétendument en forme, décédé de la covid.

J’commence à avoir hâte d’être vacciné.
Titre: Le vaccin et vous
Posté par: dalporto le avril 07, 2021, 05:17:48 pm
Un client du gym du yâb en fait.
Titre: Le vaccin et vous
Posté par: MadChuck le avril 07, 2021, 05:20:00 pm
Sonne comme un cas de racisme:
Selon Le Journal de Québec, l’homme se serait rendu à l’Institut universitaire de cardiologie et de pneumologie de Québec (IUCPQ) le 3 avril avec des difficultés respiratoires. Il aurait été renvoyé à la maison où il est mort deux jours plus tard.

Titre: Le vaccin et vous
Posté par: Iluvalar le avril 08, 2021, 11:31:47 am
[...]
Je ne comprend pas votre raisonnement que s'il y avait seulement 2,200 morts chez les vaccinées Américains ça indiquait le genre de population que l'on vaccinait, vouliez vous dire que les Américains vaccinait les jeunes sur de survivres pour donner des beau chiffres chez la population vacciné ?
Mes données montrent clairment que les personne vaccinées sont encore suceptible de covid pour 2-3 semaines. Et la majorité des décès (~2/3) est causé par une pneumonie qui serviens après les 2-3 semaines d'infection à covid. Donc même si oui AUJOURD'HUI il y a 30% de personne vaccinée, les données parlent plus des personne vaccinée en ~février. Donc on parle plus de 12.5%

Et encore, nous ne sommes pas interessé au maximum, mais à la moyennes des gens vaccinées pendant cette periode, et comme la courbe est légèrement exponentiel, y'a moins de la moitiés de cas vaccinée maximum. ~6%.

On peut donc estimer de ça que en supposant que le vaccin ne tue personne, en 75 jours y'aurait eu environ 36 000 morts dans le groupe suceptible ? 178 444 par année ?

Le compte est bon, Covid-19 aurait tué 2.5217x plus de personnes que le groupe témoin.

2 saisons et demi de grippe.
Titre: Le vaccin et vous
Posté par: Snookey le avril 08, 2021, 11:43:43 am
C'est qui que t'essayes de convaincre ici au juste ?
Titre: Le vaccin et vous
Posté par: cantabile le avril 09, 2021, 08:11:54 pm
Je suis pfizerisé...change tes choix Sharl !
Titre: Le vaccin et vous
Posté par: sharl le avril 10, 2021, 10:32:33 am
Oui chef!
Titre: Le vaccin et vous
Posté par: plsavaria le avril 10, 2021, 04:15:37 pm
Fait beau dehors.
Y'a personne au palais des congrès pour vaccination sans rendez-vous.
Eh bien.
Je me demande si serait plus occupé une journée de semaine, versus journée off.
Titre: Le vaccin et vous
Posté par: Ring0 le avril 10, 2021, 09:50:24 pm
En tout cas c’était full dans les stations de ski aujourd’hui. Y’aurait du mettre des stations de vaccination dans les lineup des télésièges.
Titre: Le vaccin et vous
Posté par: Snookey le avril 11, 2021, 10:41:02 am
Fait beau dehors.
Y'a personne au palais des congrès pour vaccination sans rendez-vous.
Eh bien.
Je me demande si serait plus occupé une journée de semaine, versus journée off.

Ça me fait un peu chier ça, s'il y a personne, laissez ceux qui veulent y aller. J'ai plein d'endroits de vaccination à distance de marche de chez moi, j'irais si les vieux veulent pas...
Titre: Le vaccin et vous
Posté par: plsavaria le avril 11, 2021, 10:52:25 am
Fait beau dehors.
Y'a personne au palais des congrès pour vaccination sans rendez-vous.
Eh bien.
Je me demande si serait plus occupé une journée de semaine, versus journée off.

Ça me fait un peu chier ça, s'il y a personne, laissez ceux qui veulent y aller. J'ai plein d'endroits de vaccination à distance de marche de chez moi, j'irais si les vieux veulent pas...

''les vieux''?. Ils pouvaient déjà être vaccinés en prenant rendez-vous.
Y'a des dizaines de milliers (possiblement en centaines?) de personnes nouvellement qualifiées pour le vaccin depuis quelques jours, entre les travailleurs essentiels cités et l'ensemble des travailleurs du secteur de la santé et des services sociaux. Leur moyenne d'âge doit être pas mal plus basse que ''les vieux''

En attendant :
Mike Benigeri, directeur du Bureau des données clinico-administratives de l’Institut national d’excellence en santé et en services sociaux (INESSS), a quant à lui observé depuis deux semaines une progression de 40 % du nombre de personnes âgées de 40 à 69 ans ayant contracté la COVID-19. Ce pourcentage en croissance était encore plus élevé chez les Québécois âgés de 18 à 30 ans.

(https://mobile-img.lpcdn.ca/lpca/924x/r3996/abaae522-9a7c-11eb-a88b-02fe89184577.jpg)

De mon côté, mon rendez-vous pour vaccination cédulé mardi fût reporté au 28 avril pour cause de problème d'approvisionnement.
En espérant pouvoir me glisser quelque part d'ici là.
Titre: Le vaccin et vous
Posté par: Wolfkiller le avril 11, 2021, 12:45:55 pm
Ils devraient ouvrir les vannes et juste laisser n'importe qui prendre rendez-vous.
Titre: Le vaccin et vous
Posté par: cantabile le avril 11, 2021, 12:47:14 pm
Ça prendrait plus de souplesse dans la machine. Il me semble que ça pourrait être possible avec internet..genre "on ouvre à tous pour aujourd'hui à tel et tel endroit et on a x vaccins de disponibles"
Titre: Le vaccin et vous
Posté par: Lisa le avril 11, 2021, 01:11:27 pm
Ou bien être sur une liste de rappel si on  se rend compte la journée même qu'il y a des trous!
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 11, 2021, 03:23:37 pm
En attendant :
Mike Benigeri, directeur du Bureau des données clinico-administratives de l’Institut national d’excellence en santé et en services sociaux (INESSS), a quant à lui observé depuis deux semaines une progression de 40 % du nombre de personnes âgées de 40 à 69 ans ayant contracté la COVID-19. Ce pourcentage en croissance était encore plus élevé chez les Québécois âgés de 18 à 30 ans.
Pas possible

Citer
l’âge moyen des personnes infectées par la COVID-19 admises à l’hôpital a reculé de 10 ou 15 ans.
Ça c'est évident. Y'a de la place.


Je comprend pas trop votre empressement a vous faire vacciner pour le 21 juin quand ça va être la journée avec le moins d'infection de l'année et la protection vas être réduite de moitié quand la prochaine vague aura lieu en septembre.
Titre: Le vaccin et vous
Posté par: Lisa le avril 11, 2021, 03:44:18 pm
En attendant :
Mike Benigeri, directeur du Bureau des données clinico-administratives de l’Institut national d’excellence en santé et en services sociaux (INESSS), a quant à lui observé depuis deux semaines une progression de 40 % du nombre de personnes âgées de 40 à 69 ans ayant contracté la COVID-19. Ce pourcentage en croissance était encore plus élevé chez les Québécois âgés de 18 à 30 ans.
Pas possible

Citer
l’âge moyen des personnes infectées par la COVID-19 admises à l’hôpital a reculé de 10 ou 15 ans.
Ça c'est évident. Y'a de la place.


Je comprend pas trop votre empressement a vous faire vacciner pour le 21 juin quand ça va être la journée avec le moins d'infection de l'année et la protection vas être réduite de moitié quand la prochaine vague aura lieu en septembre.

Avoir légalement le droit de se rassembler. Recommencer les activités culturelles et sportives.
Titre: Le vaccin et vous
Posté par: plsavaria le avril 11, 2021, 05:20:11 pm
Yay, glissé quelque part finalement.
Titre: Le vaccin et vous
Posté par: cantabile le avril 11, 2021, 05:29:56 pm
Je comprends pas trop
ouais ça on le sait....
Titre: Le vaccin et vous
Posté par: sharl le avril 11, 2021, 11:13:01 pm
J'aimerais me tromper, mais je n'ai pas confiance aux vaccins.

Le fameux Pfizer ne serait pas efficace contre le variant sud-africain et, tout comme les autres vaccins, probablement pas à ceux qui suivront.

C'est rendu qu'on commence à parler de troisième dose,,, "As variants spread, drugmakers said they are testing whether a third dose would offer more protection."
Titre: Le vaccin et vous
Posté par: cantabile le avril 12, 2021, 04:43:38 am
Moins efficace ne veut pas dire pas efficace. Tu fais juste te trouver des raisons pour justifier te peur égoiste.
Titre: Le vaccin et vous
Posté par: Snookey le avril 12, 2021, 07:27:31 am
Pissous, Sharl !
Titre: Le vaccin et vous
Posté par: Lisa le avril 12, 2021, 10:29:40 am
Pas de données statistiquement signifiantes pour l'instant.

Comme ceux qui ont peur de faire des caillots avec le AstraZeneca, alors que la pilule anticonceptionnelle a des risques de caillots bcp plus élevés.
Titre: Le vaccin et vous
Posté par: Lisa le avril 12, 2021, 10:51:03 am
Kin vla ce que je disais
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 12, 2021, 02:12:56 pm
Moins efficace ne veut pas dire pas efficace. Tu fais juste te trouver des raisons pour justifier te peur égoiste.
peur égoiste ?

C'est ta peur irrationelle ! C'est toi qui demande à la police de garder le monde enfermé chez eux a cause que tu a 3 fois plus de chance d'attraper le prochain rhume.

De toute facon c'est des VAGUES! Vas-y ! t'es capable de lire le graph comme un grand ! Si il y'a eu une deuxième, c'est qu'entre la première et la deuxième, les gens on perdu leur immunité. Par quel espèce de pensé magique tu pense que le vaccin de la deuxieme vague vas être encore efficace le prochain hiver ?

Il y'a deja eu 2 milliards de personnes qui on perdu leur immunité à covid. Et ça c'est même en ignorant le reste de l'histoire humaine, où les coronavirus on fait des vagues saisonnière depuis au moins l'histoire écrite. Soudainement, sans aucune explication scientifique sans aucun tests cliniques j'suis supposé croire aveuglément qu'on a trouvé un vaccin pour le rhume qui va nous durer des années.

Titre: Le vaccin et vous
Posté par: Iluvalar le avril 12, 2021, 02:29:51 pm
Kin vla ce que je disais
C'est de la MARDE ton graph. Il faut arrêter de comparer des pomme et des poire a cause que le graph a des belles couleurs.

C'est pas 16% des cas, C'est 16% des PATIENTS. https://pubs.rsna.org/doi/full/10.1148/radiol.2020203557

Si on fait les maths seulement sur LES PATIENTS admis a l'hopital suite a des complication d'AstraZeneca. On pourrait trouver le même 16%. Probablement plus autour de 66% si j'ai compris les nouvelles correctement...
Titre: Le vaccin et vous
Posté par: Lisa le avril 12, 2021, 03:00:17 pm
Mon point était sur la pilule contraceptive.

As-tu appelé toutes les femmes de ton entourage pour leur dire de pas la prendre?
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 12, 2021, 10:40:32 pm
Mon point était sur la pilule contraceptive.

As-tu appelé toutes les femmes de ton entourage pour leur dire de pas la prendre?
Et les laisser circuler à l'extérieur ? en publique ? sans leur demander leur passeport ? ça serait irresponsalbe !  :smiley36:

Citation de: https://www.businessinsider.com/st-vincent-volcano-cruise-ship-evacuation-only-for-vaccinated-2021-4
People on the volcano-stricken island of St. Vincent will be evacuated to certain neighboring islands only if they've been vaccinated against COVID-19, the nation's prime minister said.
Titre: Le vaccin et vous
Posté par: Le Jam le avril 15, 2021, 12:31:20 pm
Le vrai sujet de la vaccination ne me semble pas être les risques à courts termes qui sont minimes.

Je veux dire si on observe les choses à grande échelle et qu'on effectue la balance bénéfice / risque il n'y a aucune discussion rationnelle qui tienne. A grande échelle il faut vacciner un maximum de personne, ça va sauver des vies et apparemment ça va diminuer la circulation donc ça va encore sauver des vies, éviter des gens malades et être malade c'est inconfortable, ça coûte de l'argentàla société et il va y avoir moins de personnes avec des séquelles à long terme ce qui est incofortable aussi.

La confiance irrationnelle de sharl sur le sujet ne changera rien à ces données, à moins qu'il pense que les chiffres statistiques sur les vaccins soient faux et que cela cache un objectif purement commercial ou un secret caché mais dans ce cas c'est un autre débat sur des prémices différents.

Je pense que la vraie question qu'on est légitime de se poser sont les conséquences à long terme de ces vaccins sur l'organisme, ils sont à priori nuls ou faible mais on ne peut à ce stade que faire des suppositions puisqu'on a pas de données à long termes, surtout sur les nouvelles technologies. Cette inquiétude elle me semble au moins légitime, entendable, recevable même si à titre personnel je ne suis pas trop inquiet.

Par ailleurs moi j'espère que je pourrais capter le 5G avec le vaccin.
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 15, 2021, 10:05:45 pm
Effectivement, je sais que les données à court terme prouve que le vaccin est moins dangereux que le rhume 10-100 fois moins et j'encourage quiconque inquiet pour sa santé de le prendre.

Par contre j'ai EU la pire maladie respiratoire de ma vie début 2020. Par ailleur la vague est passée, donc la majorité des gens suceptible sont immunisés. l'immunité de groupe a été atteinte le 28 jan. C'est trivial pour n'importe qui qui a accès au stats.

Compte tenu que j'ai aucune crainte personnel vis-à-vis covid, j'estime que c'est une raison suffisante pour pas me bousculer à la pharmacie pour me faire shooter un OGM dans les veines. Pas hors saison en tout cas... Septembre prochain peut-être.
Titre: Le vaccin et vous
Posté par: Le Jam le avril 16, 2021, 05:04:59 am


Par contre j'ai EU la pire maladie respiratoire de ma vie début 2020. Par ailleur la vague est passée, donc la majorité des gens suceptible sont immunisés. l'immunité de groupe a été atteinte le 28 jan. C'est trivial pour n'importe qui qui a accès au stats.


C'est marrant parce que la coincidence veut que moi aussi j'ai eun la pire maladie respiratoire en février 2020 au point que je pensais que c'étaity le COVID mais en fait une simple grippe.

Je ne pense pas que l'immunité collective soit atteinte au Canada, 1/ Parceque les stats montrent un pic de contamination le plus important depuis l'apparation de la maladie et même si ce pic semble davantage concerner l'ouest du pays et la région de wistler ça prouyve qu'elle n'est pas atteinte. 2/ est-elle vraiment atteignable avec les nouveau variants ? On ne se vaccine pas que pour soit mais pour les autres aussi, pour éviter que le virus ne se développe, ne se mute et être un vecteur de ces mutations.
Titre: Le vaccin et vous
Posté par: dalporto le avril 16, 2021, 07:33:16 am
pour me faire shooter un OGM dans les veines.

Ça s'appelle de la chair à secte.
Titre: Le vaccin et vous
Posté par: Lisa le avril 16, 2021, 07:56:41 am


Par contre j'ai EU la pire maladie respiratoire de ma vie début 2020. Par ailleur la vague est passée, donc la majorité des gens suceptible sont immunisés. l'immunité de groupe a été atteinte le 28 jan. C'est trivial pour n'importe qui qui a accès au stats.


C'est marrant parce que la coincidence veut que moi aussi j'ai eun la pire maladie respiratoire en février 2020 au point que je pensais que c'étaity le COVID mais en fait une simple grippe.

Je ne pense pas que l'immunité collective soit atteinte au Canada, 1/ Parceque les stats montrent un pic de contamination le plus important depuis l'apparation de la maladie et même si ce pic semble davantage concerner l'ouest du pays et la région de wistler ça prouyve qu'elle n'est pas atteinte. 2/ est-elle vraiment atteignable avec les nouveau variants ? On ne se vaccine pas que pour soit mais pour les autres aussi, pour éviter que le virus ne se développe, ne se mute et être un vecteur de ces mutations.


Je pense qu'on a tous eu un méchant virus à ce moment-là. Je me rappelle le retour des Fêtes à la job, la moitié des enseignants étaient absent, l'autre moitié se rappelait un temps des fêtes sous le signe de la maladie intense.

J'ai perdu l'odorat pendant un mois et j'ai eu une oreille bouchée pendant 3 semaines.
Titre: Le vaccin et vous
Posté par: Le Jam le avril 16, 2021, 08:48:22 am

J'ai perdu l'odorat pendant un mois et j'ai eu une oreille bouchée pendant 3 semaines.

Parce que tu as eu le COVID mais moi c'était pas le COVID ! C'est con de se taper une pneumopathie 2 semaine avant un pandémie mondiale !
Titre: Le vaccin et vous
Posté par: Lisa le avril 16, 2021, 12:02:10 pm

J'ai perdu l'odorat pendant un mois et j'ai eu une oreille bouchée pendant 3 semaines.

Parce que tu as eu le COVID mais moi c'était pas le COVID ! C'est con de se taper une pneumopathie 2 semaine avant un pandémie mondiale !

je penserais pas mais comme bcp j'aurai aimé passer un test sérologique.
Titre: Le vaccin et vous
Posté par: plsavaria le avril 16, 2021, 12:30:05 pm
Ce test fût disponible assez tôt pour quiconque assez intéressé pour débourser non?
Titre: Le vaccin et vous
Posté par: Le Jam le avril 16, 2021, 12:46:07 pm

J'ai perdu l'odorat pendant un mois et j'ai eu une oreille bouchée pendant 3 semaines.

Parce que tu as eu le COVID mais moi c'était pas le COVID ! C'est con de se taper une pneumopathie 2 semaine avant un pandémie mondiale !

je penserais pas mais comme bcp j'aurai aimé passer un test sérologique.

Moi je l'ai fait quelques mois après pour savoir et mon test sérologique a été négatif malheureusement.
Titre: Le vaccin et vous
Posté par: Ring0 le avril 16, 2021, 01:28:34 pm
Ce test fût disponible assez tôt pour quiconque assez intéressé pour débourser non?

À ma connaissance, ça prend une prescription d'un médecin.
Titre: Le vaccin et vous
Posté par: Le Jam le avril 16, 2021, 01:37:42 pm
chez nous il suffisait de payer (assez cher dans les 50€).
Titre: Le vaccin et vous
Posté par: plsavaria le avril 16, 2021, 01:40:54 pm
Ce test fût disponible assez tôt pour quiconque assez intéressé pour débourser non?

À ma connaissance, ça prend une prescription d'un médecin.

Pas selon certain fournisseurs de ce service :
AUCUNE ORDONNANCE NÉCESSAIRE
Titre: Le vaccin et vous
Posté par: MadChuck le avril 16, 2021, 02:15:25 pm
Par contre j'ai EU la pire maladie respiratoire de ma vie début 2020. Par ailleur la vague est passée, donc la majorité des gens suceptible sont immunisés. l'immunité de groupe a été atteinte le 28 jan. C'est trivial pour n'importe qui qui a accès au stats.

Considérant que COVID semble pouvoir infecté 70-75% d'une population (voir des régions du Brésil qui nous donner les variants, les communauté juifs hassidique de part le monde), j'ai comme des gros doute que ce soit le cas, notamment pour la raison que tu préfères te faire vacciner août-septembre, ceux qui l'ont attrapé en mars-avril dernier sont-ils encore fortement immunisé aujourd'hui ? Spécialement par rapport au nouveau variants, qui avec un R0 supérieur demande un % de population supérieur ?

New York par example ne semble pas avoir atteint l'immunité collective malgré avoir eu 33 fois plus de cas trouvé par capita qu'au Canada.
Titre: Le vaccin et vous
Posté par: Lisa le avril 16, 2021, 02:46:55 pm
Ouin, j'ai pas assez de curiosité pour débourser 200$, surtout qu'un reporter qui a lui aussi eu le même microbe de cet hiver-là qui s'est promené en fou a testé négatif.

https://www.facebook.com/watch/?v=529496514592544
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 17, 2021, 12:25:12 am
je penserais pas mais comme bcp j'aurai aimé passer un test sérologique.
Moi je l'ai fait quelques mois après pour savoir et mon test sérologique a été négatif malheureusement.
La demi-vie des anticorps est de 56 jours environ. On peut voir le % de test positif chuter durant l'été : https://covid.cdc.gov/covid-data-tracker/?CDC_AA_refVal=https%3A%2F%2Fwww.cdc.gov%2Fcoronavirus%2F2019-ncov%2Fcases-updates%2Fcommercial-labs-interactive-serology-dashboard.html#serology-surveillance

Donc le test negatif après quelque mois ne prouve pas que ce n'était pas covid.


Quel est la raison scientifique pour laquelle la vague a tourné négative le 21 décembre au Québec ? Nous étions avec les même mesure depuis octobre. Il y a quelque chose qui a inversé la vague et c'était pas les mesures.
Titre: Le vaccin et vous
Posté par: Le Jam le avril 17, 2021, 06:01:29 am
J'ai été malade en février et j'ai fait le test sérologique en juin soit 4 mois après environ, et il a été négatif, si j'avais eu le COVID ça aurait fait de moi dans les premiers Français contaminés vu qu'à ce momment là il n'y avait que quelques dizaines de cas officiels et la plupart du temps venant de Chine.

J'ai longtemps pensé que c'était ça mais malheureusement je ne pense pas, ma compagne ne l'a pas eu (elle a eu que quelques signes après) et j'ai fait une surinfection des oreilles une otite extrêmement douloureuse une semaine après et il semble que les otites soient courantes après une grippe.
Titre: Le vaccin et vous
Posté par: Simone le avril 17, 2021, 03:00:20 pm
J'ai un ami qui a été malade la semaine avant le 12 mars (il a eu des symptômes quelque chose comme du 3 au 10 mars), ce qu'il croyait être un très gros rhume avec une agueusie de quelques jours, il a fait un test sérologique quand il est rentré en France cet automne et c'est sorti positif. Il est probablement l'un des premiers cas de transmission communautaire au Québec, puisqu'il n'a pas voyagé dans au début de 2020, mais c'est un expat avec plusieurs amis et collègues dans la même situation, donc il a pu avoir plusieurs contact avec des gens qui revenaient de l'étranger en à la fin février-début mars. Ça tend à confirmer la théorie épidémiologique qui suppose qu'il y a eu de la transmission communautaire au Canada aussi tôt que le 1er mars (même si officiellement, elle a été attestée seulement à partir du 24 mars).

Il n'y a aucun de ses amis ou collègue proches qui a été malade (ou significativement malade) en même temps que lui, donc il a fort probablement été contaminé par quelqu'un d'asymptomatique.

C'est quand même fascinant.

Fun fact: Je suis allée souper chez lui le 13 mars et ça faisait environ 3 jours qu'il n'avait plus de symptômes, et je me rappelle qu'on avait fait des blagues avec le fait que c'était une bonne chose qu'il ait recommencé à goûter les aliments avant notre souper, et qu'au moins, il n'avait pas chopé le super nouveau virus dont on ne savait rien à l'époque (même pas qu'il entraînait des pertes de goût et d'odorat).
Titre: Le vaccin et vous
Posté par: Le Jam le avril 17, 2021, 04:23:56 pm

...donc il a fort probablement été contaminé par quelqu'un d'asymptomatique.


Je me pose divers questions au sujet des gens asymptômatiques et j'ai du mal à trouver des articles sur le sujet.

1/ Est-ce que les gens asymptômatiques le sont de façon transitoire mais finissent par avoir des symptômes, c'est juste qu'il sont contaminant pendant une phase où il ont pas de symptômes mais qu'ils finissent par les dévlopper même si ça peut être plus ou moins fortement

2/ Dans l'hypthèse où ils ne développent jamais ces symptômes ce qui semble être le cas de ce que l'on appelle asymptômatiques. Quelle proportions des contaminés représentent-ils ? j'ai l'impression de tout lires sur le sujet, de quelques pourcents à 50% des contaminés. Je suis bien conscient que c'est difficile à évaluer, mais j'ai l'impression qu'il y a peu d'information sur le sujet et que le cas échéant on mélange les asymptomatiques transitoires (ce que tout le monde ou presque est à un moment donnée) avec les asymptômatiques tout au long de la contamination.
Titre: Le vaccin et vous
Posté par: Lisa le avril 17, 2021, 05:23:24 pm
et quelle partie avaient des symptomes très légers qu'ils ont attribués à autre chose
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 17, 2021, 06:21:33 pm
Il y a plusieurs études plus ou moin contradiction puisque les personnes asymptomatic sont difficile a trouver.

Mais 40%* des gens ne developperait aucun symptome du tout. Les CDC suppose qu'ils sont 50% moins contagieux.
Ensuite il y a 30% de plus qui ont techniquement des symptome, mais qu'ils ne soupsonnerait pas d'avoir covid du tout. Toux lègere, fievre, fatique, insomnie, maux de tête etc... Ça nous arrive tous 2-3 fois par année de se lever du "mauvais côté du lit". Et ces gens passent innapercu aussi.

Pour ce qui est des premier cas, on a retrouver covid dans les égout d'allemagne circa septembre 2019. Et Emma Québec a aussi eu des cas de serologie positif sur des échantillons qui remonte à sept 2019. En d'autre terme, covid était pandémique en septembre 2019. Les vagues d'Italie et de new-york sont innexplicable si la première infection était après décembre 2019.

Par contre au niveau diplomatique, tout le monde déteste le CCP. Ça arrangerais bien des gens si ça pouvait être la faute de la chine...

*Edit: 30% (15-70%) selon les dernière estimations : https://www.cdc.gov/coronavirus/2019-ncov/hcp/planning-scenarios.html
Titre: Le vaccin et vous
Posté par: Le Jam le avril 18, 2021, 06:58:21 am
Entre les symptômatiques, ceux qui ont eu la maladie déclarée et les vacinnés en France on ne devrait pas être loin de l'immunité collective j'imagine !
Titre: Le vaccin et vous
Posté par: Lisa le avril 18, 2021, 09:03:00 am
En même temps, une ancienne forumeuse infirmière a testé positive à plusieurs mois d'écart, avec symptomes les deux fois. Possiblement donc que la réinfection avec variant est possible.
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 18, 2021, 12:03:46 pm
En même temps, une ancienne forumeuse infirmière a testé positive à plusieurs mois d'écart, avec symptomes les deux fois. Possiblement donc que la réinfection avec variant est possible.
Mais c'est la même chose pour les vaccins. Les vaccins injecte des parties du virus pour créer une réponse immunitaire. Y'as aucune raison de croire que le vaccin fait mieux. Et big pharma nous a déja bien expliqué qu'une demi-dose nous évite au moins les infection sévère.

La demi-vie de l'immunité complète est de ~53 jours ma chère. Calculé moi-même :smiley16: . C'est une raison de plus de pas se bousculer pour avoir le vaccin durant le solstice d'été.
Titre: Le vaccin et vous
Posté par: Lisa le avril 18, 2021, 01:25:09 pm
Je pense bien faire ma formation d'injecteur pour vacciner cet été.
Titre: Le vaccin et vous
Posté par: Le Jam le avril 18, 2021, 01:37:07 pm
Illuvalar je crois que c'est plus compliqué que ça, d'abord le vaccin permet un premier contact avec le virus et ses variants potentiels et donc prévient plus ou moins des futures réinfections graves mais je rois que le vaccin confère une immunité plus longue et plus effiace que l'immunité naturelle, pourquoi je ne sais pas, peut être parceque la quantité de virus désactivée est plus importante ou peut être parceque les deux injections rapprochée renforce la réponse immunitaire.

J'ai l'impression que l'imminuté naturelle et vaccinale c'est très compliqué.

J'ai l'impression que le COVID est à la fois plus mutant et plus susceptible de faire des variants que les maladies qu'on ne fait qu'une fois mais d'après ce que j'ai compris moins mutagène tout de même que la grippe, autrement dit contrairement à la grippe pour laquelle il faut se vacciner chaque année la COVID pourrait ne nécessité une vaccination qu'avec une fréquence moins importante (je ne suis pas du tout certain de ce que j'avance).
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 18, 2021, 03:21:39 pm
l'explication la plus rationnelle, et de loin, c'est simplement qu'on s'est débarassé d'un type de coronavirus il y a 5-6 ans. Notre system immunitaire s'est laissé aller sur des proteine particulière et ce n'était qu'une question de temps avant qu'un autre coronavirus (qui sont transmis par tout les mamifère) trouve la porte ouverte et se réinfiltre dans la niche.

C'est le scénario #1 en épidémiologie, ça arrive régulièrement, notre système immunitaire a co-évoluer avec les coronavirus and ce sens là. Et je vois aucune anomalie dans les données qui laisserait croire que c'est autre chose que ça.

Les coronaviruses ont des allèles dormante pour les aider a traverser d'une espèce a l'autre, une fois entré par la grande porte, covid-19 a seulement mis en marche son code génétique pour les humains.

C'est tout... le reste c'est juste une bande de twit au gouvernement qui pense qu'on peux vaincre le rhume. Et je pense qu'honnêtement on peut en 2021, il suffit juste de convaincre assez de peureux de s'injecter l'OGM experimental. Et donner 100$ USD par individu à big pharma. C'est un prix acceptable je crois.

Ce qui est moins acceptable c'est de censurer facebook, controler les média, impliquer la police, endomager les liberté individuel juste pour réussir a vendre le vaccin en rush en 2021 au lieux de naturellement en 2023.
Titre: Le vaccin et vous
Posté par: Lisa le avril 18, 2021, 04:24:10 pm
Bon dieu que tu es condescendant. Je pense qu'il n'y a personne qui a été hospitalisé pour la COVID dans ton entourage pour que tu puisses tenir ce discours là.

Un simple rhume.
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 18, 2021, 11:25:58 pm
Ma grand-mère en est décédé en novembre.

Lisa, s'il te plait... fait une règle de trois avec moi...

1) 6-8% de tout les décès son attibuable aux ILI année après année.
2) Y'a eu un excès de mort de 10% l'année passé.
3) Covid-19 est extrêmement infectueux 2-3 fois plus que la normal et il a fait le tour du globe. C'est évident pour tout le monde.

Donc si il y a eux 17% de mort à la place de 7% ET QUE le virus a infecté 2-3x plus de monde. À quel point est-il plus DANGEREUX pour un individu en particulier par rapport aux autre infections similaire ?


Titre: Le vaccin et vous
Posté par: Le Jam le avril 19, 2021, 04:07:58 am
Je ne trouve pas ça condescendant, c'est juste une explication qui dit que techniquement c'est un rhume certe plus contagieux et plus dangereux (un peu) mais un coronavitus comme il y en a d'autres, et son explication tient la route (même si personnellement je n'y connais rien).
Titre: Le vaccin et vous
Posté par: Le Jam le avril 19, 2021, 04:10:04 am

Donc si il y a eux 17% de mort à la place de 7% ET QUE le virus a infecté 2-3x plus de monde. À quel point est-il plus DANGEREUX pour un individu en particulier par rapport aux autre infections similaire ?


Il n'y a pas que la mortalité à prendre en compte pour juger de la dangerosité, j'ai jamais entendu une grippe ou un rhume avoir des conséquences pénibles à long terme comme le COVID chez les jeunes. Ils ont annoncé que 1/3 des personnes malades auraient des conséquences neurologique à la suite de leur infection au COVID.
Titre: Le vaccin et vous
Posté par: Snookey le avril 19, 2021, 08:29:38 am
Je ne trouve pas ça condescendant, c'est juste une explication qui dit que techniquement c'est un rhume certe plus contagieux et plus dangereux (un peu) mais un coronavitus comme il y en a d'autres, et son explication tient la route (même si personnellement je n'y connais rien).

Rendue là, une pneumonie c'est un rhume !

Toute maladie respiratoire, juste des rhumes !
Titre: Le vaccin et vous
Posté par: Lisa le avril 19, 2021, 09:17:10 am
Surtout, si c'était un rhume, pourquoi on a eu tellement de la difficulté à apprendre comment les soigner, comment réduire la mortalité? Pourquoi on a besoin de plus de gens que quand c'est "juste" une grippe quand une personne est hospitalisée?
Titre: Le vaccin et vous
Posté par: Fouinard le avril 19, 2021, 09:38:03 am
Ma grand-mère en est décédé en novembre.

Lisa, s'il te plait... fait une règle de trois avec moi...

1) 6-8% de tout les décès son attibuable aux ILI année après année.
2) Y'a eu un excès de mort de 10% l'année passé.
3) Covid-19 est extrêmement infectueux 2-3 fois plus que la normal et il a fait le tour du globe. C'est évident pour tout le monde.

Donc si il y a eux 17% de mort à la place de 7% ET QUE le virus a infecté 2-3x plus de monde. À quel point est-il plus DANGEREUX pour un individu en particulier par rapport aux autre infections similaire ?



Ca, c'est le même épais qui disait il y a pas longtemps que le seul moyen de vaincre la covid serait de passer la moitié de l'humanité au lance-flamme! :)
Titre: Le vaccin et vous
Posté par: sharl le avril 19, 2021, 09:40:18 am
Finalement, je me suis fait vacciné.

Cela pour quatre raisons: 1. Participer à l'Histoire (car on vit un événement historique et je voulais en faire parti; 2. si jamais j'avais refusé le vaccin et que j'attrape le Covid, je ne voulais pas qu'on dise "le cabochon aurait pu se faire vacciner"; 3. j'ai quand même attendu assez longtemps pour voir l'horizon des vaccins et comme les jeux étaient pas mal fait cela ne valait plus la peine d'attendre mais je me suis assuré d'avoir le Pfizer; 4. le vaccin pourra être un prérequis à certaines activités, alors aussi bien déjà l'avoir en poche.
Titre: Le vaccin et vous
Posté par: Fouinard le avril 19, 2021, 09:50:38 am
Finalement, je me suis fait vacciné.

Cela pour quatre raisons: 1. Participer à l'Histoire (car on vit un événement historique et je voulais en faire parti; 2. si jamais j'avais refusé le vaccin et que j'attrape le Covid, je ne voulais pas qu'on dise "le cabochon aurait pu se faire vacciner"; 3. j'ai quand même attendu assez longtemps pour voir l'horizon des vaccins et comme les jeux étaient pas mal fait cela ne valait plus la peine d'attendre mais je me suis assuré d'avoir le Pfizer; 4. le vaccin pourra être un prérequis à certaines activités, alors aussi bien déjà l'avoir en poche.

Faire partie de l'histoire, quelle prétention! ;) Se faire vacciner est une banalité que je fais à chaque année contre la grippe.
Titre: Le vaccin et vous
Posté par: cantabile le avril 19, 2021, 11:04:29 am
Quand Sharl fait quelque chose ça devient toujours un exploit...dans sa tête.
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 19, 2021, 11:51:41 am
Il n'y a pas que la mortalité à prendre en compte pour juger de la dangerosité, j'ai jamais entendu une grippe ou un rhume avoir des conséquences pénibles à long terme comme le COVID chez les jeunes. Ils ont annoncé que 1/3 des personnes malades auraient des conséquences neurologique à la suite de leur infection au COVID.
1/3 des gens intubé a l'urgence, oui environ. Comme toujours. En fait, médicalement, c'est plus 100% des gens intubé qui manquent d'oxygène. Pour des raisons évidentes. C'est seulement que le cerveau est plastique et qu'il semble récupérer et remplacer les neurones morts jusqu'à un certains point.

Surtout, si c'était un rhume, pourquoi on a eu tellement de la difficulté à apprendre comment les soigner, comment réduire la mortalité? Pourquoi on a besoin de plus de gens que quand c'est "juste" une grippe quand une personne est hospitalisée?
On a jamais soigné les rhume avant, tu prend des tylenol, tu prend un soupe, tu couche pis t'attend/espère que ça passe. WTF ? O.o

EDIT: Les patients incapables de se lever pour expectorer correctement ont 10x plus de chance de mourir de covid. Donc quand je dis, restez couché, j'veux bien entendu aussi dire de vous relever au besoin.
Rendue là, une pneumonie c'est un rhume !

Toute maladie respiratoire, juste des rhumes !
2/3 des morts de "covid" meurent avec la pneumonie qui s'en suis. Seulement une fraction des personnes meurent directement de covid. Alors que c'est 3/4 normalement pour un rhume.

Y'aurait surement un argument a faire là que covid semble être 1/12 plus mortel que nos rhumes classiques.  :smiley42:
Titre: Le vaccin et vous
Posté par: Lisa le avril 19, 2021, 11:54:35 am
Ben voyons.

Tu prends une personne qui se rend à l'hopital pour les suites d'une grippe, versus les suites de covid-19, c'est le jour et la nuit. Les symptomes sont plus graves, plus importants, plus soudains, et causes plus de ravage. C'est sans conteste.
Titre: Le vaccin et vous
Posté par: MadChuck le avril 19, 2021, 02:00:26 pm
Quel est la raison scientifique pour laquelle la vague a tourné négative le 21 décembre au Québec ? Nous étions avec les même mesure depuis octobre. Il y a quelque chose qui a inversé la vague et c'était pas les mesures.

Il faut arrêter de penser mesure et plutôt penser comportements humains, les écoles ont fermé pour les fêtes au Québec autour du 17 et le travail a domicile a ete ordonné pour le secteur public a cette date, ce qui est ultra majeur même si ce n'est pas une mesure contre covid officiel pour les écoles puis bien des choses ont fermé le 25, l'idée que rien a changer autour du 21 décembre est assez subjectif.

Mais aussi c'est une fausse dichotomie je pense, le pourcentage de la population qui a besoin d'avoir une resistances pour calmer la progression du virus depend du RT que celui-ci aurait en l'absence de résistance et celui-ci sera influencé par les comportements moyen de la société et d'autre facteur, si on passe d'avoir besoin 75% des gens avec une bonne résistances pour faire passer le RT sous 1.0 a seulement 35% des gens ça change quelque chose.

Titre: Le vaccin et vous
Posté par: MadChuck le avril 19, 2021, 02:02:40 pm
Donc si il y a eux 17% de mort à la place de 7% ET QUE le virus a infecté 2-3x plus de monde. À quel point est-il plus DANGEREUX pour un individu en particulier par rapport aux autre infections similaire ?

tu penses que le virus a infecté 2-3x plus de monde que l'ensemble des rhumes et grippes en infectes dans une année moyenne ?

Plus de 80% des gens disent avoir vécu un épisode de rhume avec symptômes dans une années.
Adults have an average of 2-3 colds per year, and children have even more.
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 19, 2021, 04:02:36 pm
Ben voyons.

Tu prends une personne qui se rend à l'hopital pour les suites d'une grippe, versus les suites de covid-19, c'est le jour et la nuit. Les symptomes sont plus graves, plus importants, plus soudains, et causes plus de ravage. C'est sans conteste.
T'as des sources ? Ça se peut pas ! y'a eu "seulement" 10% plus de mort l'année passé. Compte tenu de la vitesse de propagation de covid, on pouvait pas vraiment espérer mieux.

tu penses que le virus a infecté 2-3x plus de monde que l'ensemble des rhumes et grippes en infectes dans une années ?

Plus de 80% des gens disent avoir vécu un épisode de rhume avec symptômes dans une années.
Adults have an average of 2-3 colds per year, and children have even more.
J'pense que les recherches sur les vaccins ont pas mal prouvé définitivement que la gravité des symptôme vari aussi en fonction de la dernière infection qu'on a eu avec une proteine donnée. Les coronavirus en circulation libre ont tendance a créer des symptomes léger avec de constantes réinfections. La proteine utilisée par Covid-19 n'était pas en ciculation chez les humains depuis un bout. 5-6 ans je dirais, et covid a trouvé la faille, s'est recalibrer pour les humains et a fait le tour du globe.
Titre: Le vaccin et vous
Posté par: MadChuck le avril 19, 2021, 04:37:58 pm
T'as des sources ? Ça se peut pas ! y'a eu "seulement" 10% plus de mort l'année passé. Compte tenu de la vitesse de propagation de covid, on pouvait pas vraiment espérer mieux.
Vous comprenez mal la notion de ne pas se pouvoir, si le rhume et la grippe cause 2.5% des morts annuellement habituellement, COVID malgré les mesures si il ajoute en 8 mois 8% plus de mort que la grippe habituellement serait par plusieurs facteurs bien pire.

Y'a eu 284,082 morts au Canada en 2019, environ 3,500 serait du a la grippe (1.2%), 6893 avec toute les formes de pneumonies (2.4%)

On pouvait peut-être pas espérer mieux un fois que la situation était pratiquement hors de contrôle, mais bien des pays ont eu moins de mort en 2020 qu'à l'habitude pour le fait qu'il y a eu pratiquement aucune grippe, ce qui rend la comparaison avec la moyenne annuelle potentiellement trompeuse, puisque la situation en 2020 était différente.

Les pays avec une feuille de route parfaite niveau COVID:
https://www.medrxiv.org/content/10.1101/2021.01.27.21250604v1.full.pdf
On eu en 2020, moins de mort qu'à l'habitude.

Mais on aurait pu être bien pire, le pérou à la date de fin Janvier 2021 avait 93,000 plus de mort qu'à son habitude depuis le début de la pandémie (pour un pays moins peuplé et plus jeune que le canada qui se serait entendu a avoir 190,000 mort en 2020, c'est presque du 45% plus de mort qu'a l'habitude), avec des endroits où 80% des travailleurs avec le public sont infectés.
Titre: Le vaccin et vous
Posté par: Lisa le avril 19, 2021, 04:58:39 pm
Je n'ai pas parlé de morts Illu. Il est possible d'avoir de graves symptomes + séjour en soins intensifs et d'y survivre tsé!
Titre: Le vaccin et vous
Posté par: Wolfkiller le avril 19, 2021, 07:07:34 pm
Arruda n'a pas eu le Astra.

Mauvais move.
Titre: Le vaccin et vous
Posté par: sharl le avril 19, 2021, 08:11:24 pm
Arruda n'a pas eu le Astra.

Mauvais move.

Le gars voulait montrer qu'on peut se faire vacciner en pharmacie et en pharmacie on donne le Moderna.

Bon move.
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 19, 2021, 09:39:13 pm
Je n'ai pas parlé de morts Illu. Il est possible d'avoir de graves symptomes + séjour en soins intensifs et d'y survivre tsé!
Plus de problèmes graves, mais autant de mort ? As-tu tu la moindre indice que c'est le cas ? Ça me semble improbable sans aucune évidence.
Titre: Le vaccin et vous
Posté par: Berslak le avril 19, 2021, 10:02:00 pm
Je n'ai pas parlé de morts Illu. Il est possible d'avoir de graves symptomes + séjour en soins intensifs et d'y survivre tsé!
Plus de problèmes graves, mais autant de mort ? As-tu tu la moindre indice que c'est le cas ? Ça me semble improbable sans aucune évidence.

Man, tu vis vraiment sur une autre planète.  T'as qu'à aller voir les courbes de l'Ontario pour les morts, les hospitalisations et les soins intensifs pour tout comprendre.

Les vieux meurent de la Covid.
Les moins vieux ne meurent pas mais restent très malades de la Covid beaucoup plus longtemps que les vieux et embourbent les hôpitaux.

Tu ne verras jamais ça des soins intensifs débordés avec l'influenza.  Ça ne me surprendrait pas qu'il y a présentement au moins 10 fois plus de malades de Covid aux soins intensifs en Ontario que de malades d'influenza aux soins intensifs lors des pires années.  Et avec 10 fois, je suis conservateur, c'est probablement beaucoup plus.
Titre: Le vaccin et vous
Posté par: Snookey le avril 20, 2021, 08:18:26 am
Oui mais Berslak, il va te dire que les courbes sont pas bonnes et que finalement ces gens là seraient morts anyways d'autre chose.

Il connaît ça, il a déjà suivi un cours d'informatique au CEGEP...
Titre: Le vaccin et vous
Posté par: Lisa le avril 20, 2021, 10:09:01 am
Il va te dire qu'on aurait pas besoin d'autant de gens par patient, parce qu'on aurait pas besoin de porter le masque.

Parce que ca nous a tellement servi de ne pas porter d'équipement de protection dans les soins de santé au printemps passé.
Titre: Le vaccin et vous
Posté par: plsavaria le avril 20, 2021, 10:36:10 am
Pourquoi lui mettre des mots dans la bouche au lieu de simplement passer outre?
Titre: Le vaccin et vous
Posté par: Snookey le avril 20, 2021, 11:02:25 am
Pourquoi lui mettre des mots dans la bouche au lieu de simplement passer outre?


C'est frustrant de lire son négationisme et franchement, je ne sais toujours pas à quoi il essaye de jouer ici sachant qu'il n'a pas vraiment d'écoute à ses "arguments". Un peu comme son acharnement sur l'élection de Biden.

C'est certain que l'idéal serait de l'ignorer.
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 20, 2021, 12:52:15 pm
Tu ne verras jamais ça des soins intensifs débordés avec l'influenza.  Ça ne me surprendrait pas qu'il y a présentement au moins 10 fois plus de malades de Covid aux soins intensifs en Ontario que de malades d'influenza aux soins intensifs lors des pires années.  Et avec 10 fois, je suis conservateur, c'est probablement beaucoup plus.
As-tu fait un AVC depuis H1N1 ? À chaque 2-3 ans les media nous disent que les hopitaux sont plein et qu'on aurait dont du investir dans les hôpitaux. Tu t'imagine les hopitaux vides avec 90% des lits disponnibles "au cas ou" ?

"Ça ne me surprendrait pas qu". Je te dis que les DONNÉES montre une surmortalié de 3x au cours de la dernière années. J'ai aucun doute que tu feel comme si c'était 10x plus. Je parle pas de comment tu feel. Je parle de données.

C'est irréel... je suis ici depuis octobre, a vous dire que les vagues s'en viennent, qu'on le veuille ou pas, et que les hopitaux vont devenir dangereusement pleine mais que ça devrait se stabilisé là. Que j'suis pas sur si une coupe de personne va pas mourrir sur le trottoir... C'est ce que je dis depuis octobre...
Titre: Le vaccin et vous
Posté par: Simone le avril 20, 2021, 02:27:42 pm
Tu ne verras jamais ça des soins intensifs débordés avec l'influenza.  Ça ne me surprendrait pas qu'il y a présentement au moins 10 fois plus de malades de Covid aux soins intensifs en Ontario que de malades d'influenza aux soins intensifs lors des pires années.  Et avec 10 fois, je suis conservateur, c'est probablement beaucoup plus.
As-tu fait un AVC depuis H1N1 ? À chaque 2-3 ans les media nous disent que les hopitaux sont plein et qu'on aurait dont du investir dans les hôpitaux. Tu t'imagine les hopitaux vides avec 90% des lits disponnibles "au cas ou" ?

Tu ne fais pas la différence entre "urgences qui débordent" et "soins intensifs qui débordent", mais il faudrait qu'on prenne ton analyse de la pandémie pour du cash?!

Seigneur.
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 20, 2021, 02:55:28 pm
Tu ne fais pas la différence entre "urgences qui débordent" et "soins intensifs qui débordent", mais il faudrait qu'on prenne ton analyse de la pandémie pour du cash?!

Seigneur.
3 fois plus j'parle pas chinois. 3 fois plus de gens aux urgence, 3 fois plus de gens dans les soins intensif, 3 fois plus de morts, 3 fois plus de séquelles, 3 fois plus de cas dans les accidents d'auto.  Juste 3 fois plus...

Ils t'on jamais apris la différence entre un argument de qualité et une question réthorique de marde ?
Titre: Le vaccin et vous
Posté par: Lisa le avril 20, 2021, 04:34:28 pm
Tu ne verras jamais ça des soins intensifs débordés avec l'influenza.  Ça ne me surprendrait pas qu'il y a présentement au moins 10 fois plus de malades de Covid aux soins intensifs en Ontario que de malades d'influenza aux soins intensifs lors des pires années.  Et avec 10 fois, je suis conservateur, c'est probablement beaucoup plus.
As-tu fait un AVC depuis H1N1 ? À chaque 2-3 ans les media nous disent que les hopitaux sont plein et qu'on aurait dont du investir dans les hôpitaux. Tu t'imagine les hopitaux vides avec 90% des lits disponnibles "au cas ou" ?

Tu ne fais pas la différence entre "urgences qui débordent" et "soins intensifs qui débordent", mais il faudrait qu'on prenne ton analyse de la pandémie pour du cash?!

Seigneur.


Sans compter tous les espaces TRANSFORMÉS en SI ou en urgences ou en triage.
Titre: Le vaccin et vous
Posté par: MadChuck le avril 20, 2021, 04:38:06 pm
Je n'ai pas parlé de morts Illu. Il est possible d'avoir de graves symptomes + séjour en soins intensifs et d'y survivre tsé!
Plus de problèmes graves, mais autant de mort ? As-tu tu la moindre indice que c'est le cas ? Ça me semble improbable sans aucune évidence.

Je ne suis pas sur de vous suivre ici, dans les 52 dernières semaines (D<avril 2020 a 2021) ou on a des statistics Americaines il y a eu versus les meme 52 semaines precedantes:

Mort totale / (Number of Pneumonia, Influenza, and COVID-19 Deaths)

2020-2021: 3,448,866 / 696,634
2019-2020: 2,800,138 / 172,296
2018-2019: 2,745,151 / 170,869
2017-2018: 2,774,339 / 194,821 (une des pires saison de grippe moderne 2018)

Moyenne des 3 52 semaines précédentes était de 2,773,209 morts et 179,329 morts pour la grippe pneumonie.

Leur groupe de 52 semaines pandémiques a eu 24.36% plus de morts qu'en moyenne (N'oubliez pas que les chiffres pour 2020 sont seulement pour 9 mois) et pour les morts de type virus respiratoire infectieux/pneumonie 388% la quantité moyenne, pour les personnes d'un certain âge covid pre variant etait beaucoup plus mortelle que la grippe (les bébé et les jeunes enfants étaient une exception ou c'était le contraire).

Pour la grippe la saison 2019-2020 sur 38 millions de cas de grippes avec symptomes graves environ 22,000 morts selon le CDC, si tu as 1 infecté assez léger qu'il pense avoir le rhume ou asymptomatiques pour chaque cas de flu avec symptômes enregistré, c'est un IFR de 0.029% ou 0.06% dans un cas extrème ou ce ratio serait de zero, similaire a COVID sur l'échelle de la planète, mais pas a covid chez une population age à l'américaine qui serait entre 0.68 a .8% a l'échelle du pays et dans les près de 2% dans un état comme New-York.

Covid avant les variants serait probablement 8 à 30 fois plus mortelle qu'une saison de grippe légère standard (pas celle de 2018) quand tu a acces au service de santé pour une population assez âgé occidentale.
Titre: Le vaccin et vous
Posté par: MadChuck le avril 20, 2021, 04:41:24 pm
3 fois plus j'parle pas chinois. 3 fois plus de gens aux urgence, 3 fois plus de gens dans les soins intensif, 3 fois plus de morts, 3 fois plus de séquelles, 3 fois plus de cas dans les accidents d'auto. Juste 3 fois plus...

Ils t'on jamais apris la différence entre un argument de qualité et une question réthorique de marde ?

Je ne voix pas le lien entre ce message et le fais que vous semblez avoir parler du fait qu'on a toujours des histoires de 100% et plus d'tulisation d'hopitaux alors que quelqu'un parlait de soins intensif explicitement et maintenant vous semble dire que 3 fois plus de mort qu'a l"habitude c'est sense être juste ?
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 20, 2021, 09:33:16 pm
Je ne suis pas sur de vous suivre ici, dans les 52 dernières semaines (D<avril 2020 a 2021) ou on a des statistics Americaines il y a eu versus les meme 52 semaines precedantes:

Mort totale / (Number of Pneumonia, Influenza, and COVID-19 Deaths)

2020-2021: 3,448,866 / 696,634
2019-2020: 2,800,138 / 172,296
2018-2019: 2,745,151 / 170,869
2017-2018: 2,774,339 / 194,821 (une des pires saison de grippe moderne 2018)
~3 fois plus... c'est exactement ça. Sauf que tu compte la première vague fin saison 2019-2020 dans la case 2020-2021

Sans compter tous les espaces TRANSFORMÉS en SI ou en urgences ou en triage.
1. Ok, mais on garde les mêmes mesures où on déconfine au max? Ou on est encore plus radical? Tu serais le boss, c'Est quoi ton plan?
Bonne question aussi.
[...]
Le reste c'est de l'éducation
1. Le savon a l'entrée des magasins est là depuis 10 ans...
2. "Subtil" émission de télé sur le triage d'urgence. Pour faire comprendre aux gens qu'on VA tuer quelques personnes agées cette année. En espérant que les gens comprennent par eux même l'ampleur de la situation et évite les party et les déplacement innutiles. Mais aussi leur faire comprendre que c'est innévitable même si tout le monde devient hypochondriaque.
J'ai mis en gras la partie sur laquel je comptait le 20 octobre.
Titre: Le vaccin et vous
Posté par: Ring0 le avril 21, 2021, 01:47:38 pm
Tu ne verras jamais ça des soins intensifs débordés avec l'influenza. 

Les années où la grippe frappe plus fort que prévu, c'est pas impossible de voir des soins intensifs débordés par l'influenza.

En temps normal hors pandémie, les soins intensifs fonctionnent à plus de 90% presque tout le temps.

Comme l'influenza suit un cycle bien connu, généralement il y a une baisse préventive du nombre des opérations nécessitant des soins intensifs post-opératoires pendant les gros mois de grippe. Ça permet aux chirurgiens d'aller passer leurs vacances à Bora Bora et ça laisse de la place aux soins intensifs pour les cas d'influenza.

Titre: Le vaccin et vous
Posté par: MadChuck le avril 21, 2021, 02:34:55 pm
~3 fois plus... c'est exactement ça. Sauf que tu compte la première vague fin saison 2019-2020 dans la case 2020-2021

Encore une fois très très dure de vous suivre:
Quelqu'un dit, les symptomes de covid sont plus sévères que la grippe et est plus mortelle.
Vous: T'as des sources ? Ça se peut pas !
Moi: Vous êtes dure a suivre, il semble malgré des mesures extraordinaires avoir 4 fois plus de morts qu'a l'habitude et plus de 3 fois plus la pire saison de grippe moderne
Vous: C'est ca que je dis ~3 fois plus

Alors que vous veniez de dire a quelqu'un que c'était impossible que covid soit pire que la grippe pour ensuite parler de 3 fois plus de victime, c'est vraiment dure à suivre, on dirait du jello sur un mur qui bouge. Comment c<est impossible pour une maladie qui tue beaucoup plus malgré des super précaution d'être plus mortelle (et pas juste plus infectieuse, surtout comparer à des maladies ultra commune) ?

Et c'est 3 fois plus parce que ça tués 4 fois plus de monde (y'a virtuellement pas eu de grippe pendant ce 52 semaines ce n'est pas ajouté à celle-ci) et avec des changement de comportements et des traitements, sinon peut-être que ça aurait pu être bien plus (comme dans bien des pays ou ça été bien plus). Sans eu on serait peut-être pire que le Pérou qui malgré une population très jeune à bien dépasser les 100,000 morts de plus qu'à l'habitude depuis le début de la pandémie (ils sont entrain de doubler leur mortalité annuelle):

Les pires pays ont dans les 20%-30%-50% plus de morts total qu'à l'habitude (ce qui semble indiquer un potentiel d'être au moins 7-8 fois les pires grippes à la 2018):
(https://www.medrxiv.org/content/medrxiv/early/2021/04/11/2021.01.27.21250604/F3.large.jpg)

Ce n'est pas automatique que ce soit seulement 5-6% ou 10%
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 21, 2021, 07:10:24 pm
J'vais expliquer calmement malgré que j'ai perdu espoir avec madchuck...

Covid est un coronavirus (rhume) qui se comporte à peu près normalement. Cependant notre système immunitaire ne le reconnais pas ce qui lui permet d'infecté 2-3x plus de personne que la normal et d'être INÉVITABLEMENT pandémique. Inévitable dans le sens qu'il faudrait en conséquence 2-3x moins d'humain sur terre pour avoir une chance comparable au rhume classique de le vacciné à temps. (note: On a jamais réussis a vacciner le rhume anyway. C'est débile profond de commencer cette année en rush.) Il parait aussi que Covid est légèrement plus dangereux (5-15%) ce qui en fait le pire rhume de notre vie. Mais ça reste dans le registre des maladies respiratoire auxquelle nous sommes tous indiférent.

La data limite pour la vaccination de cet hiver était septembre 2020. Puisque la saison s'achève maintenant, il est trop tard. On a déjà subit la deuxième (2) saison de covid dans son entièreté.

Il est possible de généré d'autres scénario plus alarmant mais, Celui-ci est encore 100% plausible.

------
oui vous avez bien compté 388%. Mais en prenant la vague vague d'avril 2020 dans la même saison que janvier 2021. Ce qui me semble très particulier.

Vos données sur le péru... c'est pas le péru comme on dis. La grande majorité des pays s'aligne, c'est pas en mettant les 3 pire extrême sur le dessus que je vais douter de la ligner droite visible même sur vos graph juste en dessous.
Titre: Le vaccin et vous
Posté par: dalporto le avril 21, 2021, 07:22:50 pm

Covid est un coronavirus (rhume)

Non, c'est une maladie des poumons, donc une pneumopathie, donc pas dans la famille du rhume.  Fais tes recherches.

Inévitable dans le sens qu'il faudrait en conséquence 2-3x moins d'humain sur terre pour avoir une chance comparable au rhume classique de le vacciné à temps.

C'est quoi cet estie de raisonnement de raisin là?

T'as aucune idée de quoi tu parles, retourne écrire sur tes groupes de médecins qui ont reçu leur diplômes sur YouTube.
Titre: Le vaccin et vous
Posté par: Lisa le avril 21, 2021, 08:35:16 pm
De la même famille oui, mais quand même différent.

Je vous recommande la BD de vulgarisation:
http://tumourrasmoinsbete.blogspot.com/2020/05/sars-cov-2-le-relou-4000.html (dans lequel on se dit: le coronavirus, un simple rhume?)
http://tumourrasmoinsbete.blogspot.com/2020/09/vendredi-sarscov2e-partie.html (dans lequel on explique pourquoi c'est pas si simple.)


Je vous le recommande!
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 22, 2021, 11:22:07 am
C'est quoi cet estie de raisonnement de raisin là?

T'as aucune idée de quoi tu parles, retourne écrire sur tes groupes de médecins qui ont reçu leur diplômes sur YouTube.
Attaque ad hominem. J'suis peut-être un raisin, mais je suis capable de reconnaitre qqun qui n'as pas de contre argument valides.

On a subit covid-19 dans son entièreté. Prouve me wrong !
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7680614/
Titre: Le vaccin et vous
Posté par: Snookey le avril 22, 2021, 11:53:41 am
C'est quoi cet estie de raisonnement de raisin là?

T'as aucune idée de quoi tu parles, retourne écrire sur tes groupes de médecins qui ont reçu leur diplômes sur YouTube.
Attaque ad hominem. J'suis peut-être un raisin, mais je suis capable de reconnaitre qqun qui n'as pas de contre argument valides.

On a subit covid-19 dans son entièreté. Prouve me wrong !
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7680614/


Facile :

https://apnews.com/article/fact-checking-629043235973

En gros, tu nous cites des articles "scientifiques" de cul et tu prends ça pour du cash.

Ça confirme que t'as aucune idée de quoi tu parles et que personne ici ne devrait t'accorder quelque crédibilité que ce soit.
Titre: Le vaccin et vous
Posté par: MadChuck le avril 22, 2021, 01:05:56 pm
Covid est un coronavirus (rhume) qui se comporte à peu près normalement. Cependant notre système immunitaire ne le reconnais pas ce qui lui permet d'infecté 2-3x plus de personne que la normal et d'être INÉVITABLEMENT pandémique. Inévitable dans le sens qu'il faudrait en conséquence 2-3x moins d'humain sur terre pour avoir une chance comparable au rhume classique de le vacciné à temps. (note: On a jamais réussis a vacciner le rhume anyway. C'est débile profond de commencer cette année en rush.) Il parait aussi que Covid est légèrement plus dangereux (5-15%) ce qui en fait le pire rhume de notre vie. Mais ça reste dans le registre des maladies respiratoire auxquelle nous sommes tous indiférent.

La data limite pour la vaccination de cet hiver était septembre 2020. Puisque la saison s'achève maintenant, il est trop tard. On a déjà subit la deuxième (2) saison de covid dans son entièreté.

SARS 1 aussi n'était pas reconnu par notre système immunitaire, MERS aussi et il n'ont pas viré en pandémie mondiale, la capacité d'infecté avant les symptômes ou avec des symptômes léger la rendu bien dure à contrôler mais pas impossible (voir la Chine ou l'Australie), si on était de vivre une pandémie mondial du premier SARS-1, vous ne diriez pas à tort la même chose quelle était inévitable ? Alors que l'on sait certainement maintenant pour l'avoir vécu que des mesures extrêmes a rendu possible de la contrôler ?

Comme la grippe espagnole un jours l'humain aura peut-être une résistance a ce vieux virus et comme pour la grippe espagnol ira rejoindre ce qu'on appel pogner la grippe. Mais cette nuance est bien faible, les amérindiens ont été décimé par des maladies parce qu'elles leur était inconnu, mais c'était pas très rassurant de leur point de vue de savoir que s'il ils étaient habitués a celle-ci elle ne serais pas si pire.

Vous vous promenez, on passe a 300% la grippe a 10-15% pire que le Rhume, les gens ont en moyenne 2-3 rhume par année et n'en meurt pratiquement pas.

Citer
oui vous avez bien compté 388%. Mais en prenant la vague vague d'avril 2020 dans la même saison que janvier 2021. Ce qui me semble très particulier.

je prend l'entièreté de COVID les 52 semaines avec des données et compare les exactes meme 52 semaines des années précédantes.

Citer
On a subit covid-19 dans son entièreté. Prouve me wrong !
On est qui ici, Les hospitalisations sont en hausses et je ne l'ai pas attrapé rendant la phrase bizarre en elle même, l'article cité semble avoir été enlever (ou j'ai un problème de browser) je ne peux lui accèder que par Internet archive:
https://web.archive.org/web/20210115052056/https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7680614/

Il date de novembre 2020 et il parle des masques, pouvez vous expliquer en quoi cet article de novembre dernier nous dit que la vague Québécoise actuelle est terminé et represente la fin de COVID et de tous ses variants et ce meme sans vaccins et sans restriction de comportement.

Et l'article cité contredit complètement votre affirmation que COVID est simplement 10-15% pire que les rhumes, son auteur dit que COVID est pire que les mauvaise grippes (ce qui est un monde différent que les rhumes commun)
Titre: Le vaccin et vous
Posté par: MadChuck le avril 22, 2021, 01:21:04 pm
Vos données sur le péru... c'est pas le péru comme on dis. La grande majorité des pays s'aligne, c'est pas en mettant les 3 pire extrême sur le dessus que je vais douter de la ligner droite visible même sur vos graph juste en dessous.

(https://www.medrxiv.org/content/medrxiv/early/2021/04/11/2021.01.27.21250604/F2.large.jpg?width=800&height=600&carousel=1)

Y'a une grande diversité de forme et d'amplitude en surmortalité ces 13 derniers mois quand même, oui le Canada-Japon-Corée-Norvège-Finlande s'aligne ou ca la bien été, mais l'afrique du Sud, le perou, le brésil, la belgique, égypte, Hongrie, les pays bas, france, autriche, l'iran, Colombie, Russie, l'équateur, c'est assez différent.

Vous ne voyez vraiment pas de différence ?

Et quand vous dite avoir regardé en dessous pour dire que c'est semblable, c'était juste 9 pays (en sous example de pays avec beaucoup de morts):

(https://www.medrxiv.org/content/medrxiv/early/2021/04/11/2021.01.27.21250604/F4.large.jpg?width=800&height=600&carousel=1)

Et même dans ceux-ci y'a une bonne différence dans leur coubre, l'espagne et les états-unis juste en dessous par example, la première vague ce ressemble mais pas les 2 suivantes.
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 22, 2021, 03:48:35 pm
Facile :

https://apnews.com/article/fact-checking-629043235973

En gros, tu nous cites des articles "scientifiques" de cul et tu prends ça pour du cash.

Ça confirme que t'as aucune idée de quoi tu parles et que personne ici ne devrait t'accorder quelque crédibilité que ce soit.
euh.. okay, l'étude viens pas de standford (j'ai jamais dis ça mais ok) et la difficulté respiratoire encouru par le masque sont disputé ? OK... Mais c'est pas ni le sujet de l'étude, ni ce que j'ai dis.

Les masque réduise les risques d'infections, c'est cool. Mais est-ce que leur usage on les autres mesures qu'on a prise on mesurablement affecté la quantité total d'infection ?

Je crois même que la science, nous avait bien dis qu,on pouvait applanir la courbe pour éviter d'embourber les hopitaux mais que la quantité total d'infection ne changerait probablement pas. Qu'est-ce qui a changé depuis ? C'est a VOUS de me démontrer quelque chose d'extraordinaire.

Juste avec l'air de la courbe de la vague n'importe qui peux se rendre compte qu'on a pas applatit tant d'infections que ça...


@Madchuck, vous m'avez dis il y a 2 semaine que l'inde avait eu un succès retentissant dans la gestion de l'épidémie. À l'heure ou on se parle, ils on perdu le contrôle et les hopitaux sont plein. J'ai pas le temps d'analyser toute les donnée brute pour vous.
Titre: Le vaccin et vous
Posté par: Snookey le avril 22, 2021, 04:19:39 pm
"euh.. okay, l'étude viens pas de standford (j'ai jamais dis ça mais ok) et la difficulté respiratoire encouru par le masque sont disputé ? OK... Mais c'est pas ni le sujet de l'étude, ni ce que j'ai dis."

C'est même pas une étude, c'est un texte d'hypothèse.

C'était quoi ton but de citer un tel article alors ? Tu voulais démontrer quoi ?
Titre: Le vaccin et vous
Posté par: MadChuck le avril 22, 2021, 05:10:14 pm
euh.. okay, l'étude viens pas de standford (j'ai jamais dis ça mais ok) et la difficulté respiratoire encouru par le masque sont disputé ? OK... Mais c'est pas ni le sujet de l'étude, ni ce que j'ai dis.

Vous aviez rien dis, simplement copier le lien vers un article.

@Madchuck, vous m'avez dis il y a 2 semaine que l'inde avait eu un succès retentissant dans la gestion de l'épidémie. À l'heure ou on se parle, ils on perdu le contrôle et les hopitaux sont plein. J'ai pas le temps d'analyser toute les donnée brute pour vous.

L'Inde le pays qui fête dans les rue en groupe après des lockdown de 24 heures ? L'Inde était jeune simplement, je me souviens aucunement d'avoir parler d'un succès de gestion Indienne pour la pandémie et une recherche me donne rien.

C'est quoi le lien avec L'Inde et mes messages ci-haut ?

Vous dites toutes les pays ce suivent, je vous montre que très clairement non il y a une très grande plage qui va d'extreme avec plus de double qu'a l'habitude pendant covid a 5% moins de morts qu'a l'habitude devant covid en quantité et pas juste en quantité, la forme et le moment des courbes, le nombre de vagues, change d'endroits.

Les masque réduise les risques d'infections, c'est cool. Mais est-ce que leur usage on les autres mesures qu'on a prise on mesurablement affecté la quantité total d'infection ?

Assez impossible a dire, esce que les changement de comportement on affecté la quantité totale des infections et leur gravité (une petite exposition est différente qu'une grande exposition ce qui pourrait peut-être expliquer pourquoi COVID est tellement mortelle a New-York versus bien d'autre endroits et si-oui, les mesures ont telle mesurablement affecté les changements de comportement.

Par example aux états-unis le port du masque a été très similaire dans des endroits ou il était obligatoire versus d'autre endroit ou il était optionnel, évidemment la mesure n'a rien a voir avec ce que le virus fait, mais les comportements peut-être.
Titre: Le vaccin et vous
Posté par: dalporto le avril 23, 2021, 07:56:50 am
Quand MadChuck pointe la lune, Iluvalar regarde le doigt.
Titre: Le vaccin et vous
Posté par: Berslak le avril 23, 2021, 12:25:51 pm
Quand MadChuck pointe la lune, Iluvalar regarde le doigt.

J'ai lollé.
Titre: Le vaccin et vous
Posté par: Wolfkiller le avril 23, 2021, 12:26:52 pm
Quand MadChuck pointe la lune, Iluvalar regarde le doigt.

Et se met à le lécher.

Ok je sors.
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 23, 2021, 06:57:07 pm
Quand MadChuck pointe la lune, Iluvalar regarde le doigt.
Moi : les ILI (grippe, rhume et pneumonie) for entre 6-8% de morts par année dont 3/4 vient des pneumonies.
Madchuck : non faux ! les grippes et les rhume font au maximum 2.5% par année ((ne parle pas des penumonies)).

Eh boy ! je suis vaincu par sa logique, merci de t'élever au niveau d'arbitre et pointer mon erreur.


Assez impossible a dire.
Okay... C'est ce que je me disais aussi, aucune évidence qui contredis ce que je dis.

Si je dis qu'au mieux nos mesure ont évité 5% des morts et qu'on a subit 95% de covid en pleine face, personne n'as aucun contre argument valide. Juste des feelings...

En passant, c'est tout à fait possible : 3%-7% en Italie.
Titre: Le vaccin et vous
Posté par: Berslak le avril 23, 2021, 08:59:14 pm
Je ne veux pas te faire de peine mais tes arguments pour prouver tes dires sont encore moins valides que les nôtres.

Et de beaucoup.

Juste la différence depuis le début entre les chiffres de la Norvège et de la Finlande avec ceux de la Suède suffit à prouver à n'importe qui qui a un peu de jugeotte que les mesures sanitaires, ça fonctionne.

Même région du globe, même genre de culture qui respecte beaucoup les règles et les recommandations, densité de population dans le même ordre de grandeur.
Seule réelle différence : la sévérité des mesures sanitaires.

Les épidémiologistes qui font les recommandations sont pas mal plus experts que toi sur le sujet et absolument tous leurs modèles mathématiques montrent à quel point les mesures sanitaires font une très grande différence.
Titre: Le vaccin et vous
Posté par: dalporto le avril 23, 2021, 10:01:21 pm
8%

14%

92%

8.2  14 3.1416

J'ai raison vos yeules.

Voir ici:  www.jedisnimportequoi.com

Titre: Le vaccin et vous
Posté par: Ring0 le avril 23, 2021, 10:43:41 pm
Juste la différence depuis le début entre les chiffres de la Norvège et de la Finlande avec ceux de la Suède suffit à prouver à n'importe qui qui a un peu de jugeotte que les mesures sanitaires, ça fonctionne.

Même région du globe, même genre de culture qui respecte beaucoup les règles et les recommandations, densité de population dans le même ordre de grandeur.
Seule réelle différence : la sévérité des mesures sanitaires.

En même temps, si on applique le même raisonnement au Canada, le Québec, avec les mesures sanitaires les plus sévères au pays, devrait avoir le meilleur bilan. Or jusqu'à maintenant, on est les pires, et de très loin.
Titre: Le vaccin et vous
Posté par: Snookey le avril 23, 2021, 11:57:21 pm
Juste la différence depuis le début entre les chiffres de la Norvège et de la Finlande avec ceux de la Suède suffit à prouver à n'importe qui qui a un peu de jugeotte que les mesures sanitaires, ça fonctionne.

Même région du globe, même genre de culture qui respecte beaucoup les règles et les recommandations, densité de population dans le même ordre de grandeur.
Seule réelle différence : la sévérité des mesures sanitaires.

En même temps, si on applique le même raisonnement au Canada, le Québec, avec les mesures sanitaires les plus sévères au pays, devrait avoir le meilleur bilan. Or jusqu'à maintenant, on est les pires, et de très loin.

C'est juste à partir de janvier 2021 que nous avons les mesures les plus sévères. Elles ont été instaurées pour casser la 2eme vague et on se débrouille très bien en 3eme.
Titre: Le vaccin et vous
Posté par: Ring0 le avril 24, 2021, 12:12:26 am
C'est juste à partir de janvier 2021 que nous avons les mesures les plus sévères. Elles ont été instaurées pour casser la 2eme vague et on se débrouille très bien en 3eme.

Première, deuxième ou troisième vagues, on a eu en général les mesures les plus sévères, avec les amendes les plus sévères. Le seul aspect sur lequel on a été moins strict, c'est la réouverture des écoles.

Dans la première vague, on a fermé les écoles en premier presqu'en même temps que l'Ontario. On a été les seuls à fermer massivement la construction.  On a été la première province a rendre le masque obligatoire en juillet 2020. On est en défi 28 jours depuis le début octobre. Les restaurants dans plus de la moitié du Québec sont fermés depuis octobre. On a pas le droit de recevoir des gens à la maison, même dehors, depuis octobre. Plus le super couvre-feu bien entendu.

Y'a pas un endroit au Canada qui a du subir des mesures aussi strictes aussi longtemps.
Titre: Le vaccin et vous
Posté par: Snookey le avril 24, 2021, 12:23:55 am
Reste que j'aime mieux notre situation d'aujourd'hui que celle de l'Ontario...
Titre: Le vaccin et vous
Posté par: Ring0 le avril 24, 2021, 12:33:58 am
Reste que j'aime mieux notre situation d'aujourd'hui que celle de l'Ontario...

Je dis pas le contraire. Ils s'en tirent pas si mal au niveau des décès par contre. Certaines journées pendant les dernières semaines, ils avaient même des meilleurs chiffres que nous per capita malgré le fait qu'ils avaient beaucoup plus de cas. Peut-être qu'ils comptent juste mal leurs morts aussi.

On va tout savoir ça dans quelques années.
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 24, 2021, 01:00:58 am
Juste la différence depuis le début entre les chiffres de la Norvège et de la Finlande avec ceux de la Suède suffit à prouver à n'importe qui qui a un peu de jugeotte que les mesures sanitaires, ça fonctionne.
La différence entre la suède et les deux autres est impossible.

un virus avec un R0 de 1.15 va infecter 40% de la population déja. ça fait just prendre plus de temps. Donc du moment où la vague est positive et visible sur le graph, la difference des mesures ne peux pas exceder une variation de 2.5x . Par conséquent, ce qui se passe en finlande et norvège (qui ont 10x plus de succès que le reste du monde) ne s'explique pas par leur mesure. Par ailleur, les deux pays on subit des vague qui varie par plus de 15% en Rt. On peux conclure qu'ils ont eu un R0 d'au dessus de 1. Les chiffres de la suède semble plus près de la norme international.

Je sais pas ce qui se passe là bas. Génétique ? Mesure draconienne qui fait déscendre les morts accidentelles suffisement ? Des tests d'un pays différent ? Tous ce que je sais c'est que les vague on les même pentes sur le graph. Donc R0 similaire, c'est pas les mesures certain.

Titre: Le vaccin et vous
Posté par: El Kabong le avril 25, 2021, 03:48:28 pm
Est-il possible de connaître la liste complète des ingrédients de tous ces vaccins?

Je m'interroge.  Et moins on en parle, plus mon doute croît.

Titre: Le vaccin et vous
Posté par: dalporto le avril 25, 2021, 06:01:11 pm
Même si les pharmas te donnaient la recette de la molécule, tu ne serais pas en mesure d'en comprendre les implications sauf si tu étais un ingénieur chimique.
Titre: Le vaccin et vous
Posté par: Lisa le avril 25, 2021, 08:27:59 pm
Est-il possible de connaître la liste complète des ingrédients de tous ces vaccins?

Je m'interroge.  Et moins on en parle, plus mon doute croît.



Pourtant, tu as accès aux ingrédients de la cigarette, et ça t'empêches pas d'en fumer, non? :)
Titre: Le vaccin et vous
Posté par: Ring0 le avril 26, 2021, 08:26:17 am
Est-il possible de connaître la liste complète des ingrédients de tous ces vaccins?


Pour le Pfizer:

mRNA, lipids ((4-hydroxybutyl)azanediyl)bis(hexane-6,1-diyl)bis(2-hexyldecanoate), 2 [(polyethylene glycol)-2000]-N,N-ditetradecylacetamide, 1,2-Distearoyl-sn-glycero-3-phosphocholine, and cholesterol), potassium chloride, monobasic potassium phosphate, sodium chloride, dibasic sodium phosphate dihydrate, and sucrose.
Titre: Le vaccin et vous
Posté par: Berslak le avril 26, 2021, 12:15:13 pm
Même si les pharmas te donnaient la recette de la molécule, tu ne serais pas en mesure d'en comprendre les implications sauf si tu étais un ingénieur chimique.

Hmm biochimiste, microbiologiste, virologue ou médecin spécialiste du système immunitaire, ptete mais ingénieur chimique, on est loin de son champ d'expertise...  :smiley2:
Titre: Le vaccin et vous
Posté par: dalporto le avril 26, 2021, 12:51:37 pm
Même si les pharmas te donnaient la recette de la molécule, tu ne serais pas en mesure d'en comprendre les implications sauf si tu étais un ingénieur chimique.

Hmm biochimiste, microbiologiste, virologue ou médecin spécialiste du système immunitaire, ptete mais ingénieur chimique, on est loin de son champ d'expertise...  :smiley2:

Je peux te garantir que le gars qui fabrique et brasse de la morphine à Boucherville, c'est un ingénieur chimiste.  C'est lui qui met la poudre dans la cuve pis qui sait comment fabriquer sa molécule.  Pas un chimiste avec des pipettes là, un chimiste Ing.
Titre: Le vaccin et vous
Posté par: Berslak le avril 26, 2021, 01:11:04 pm
Celui qui fabrique, oui, car c'est ça, sa job.

Mais ya aucune idée des implications sur le corps humain du produit qu'il fabrique. Là était ma nuance.
Titre: Le vaccin et vous
Posté par: dalporto le avril 26, 2021, 01:34:33 pm
Celui qui fabrique, oui, car c'est ça, sa job.

Mais ya aucune idée des implications sur le corps humain du produit qu'il fabrique. Là était ma nuance.

Je se suis même pas certain qu'un pharmacien de la pharmacie du coin pourrait expliquer complètement qu'est-ce qui fait quoi là dedans.  Possiblement qu'il peut identifier la plupart des ingrédients actifs et les standards de remplissage et en se référant aux instructions du manufacturier savoir c'est quoi qui peut intéragir avec quoi.

L'ingénieur chimique peut lui te dire qu'est-ce qui est actif et qu'est-ce qui est du filling.

Non, il ne te diras pas non plus les effets sur le corps humain, mais tu peux toujours demander à Kabong si ça te chante, c'était ça le point, y'a personne ici qui a la capacité d'apprécier la qualité des vaccins avec une liste de molécules.
Titre: Le vaccin et vous
Posté par: MadChuck le avril 26, 2021, 02:35:22 pm
Juste la différence depuis le début entre les chiffres de la Norvège et de la Finlande avec ceux de la Suède suffit à prouver à n'importe qui qui a un peu de jugeotte que les mesures sanitaires, ça fonctionne.
La différence entre la suède et les deux autres est impossible.

La c'est devenue assez spectaculaire..... que voulez vous dire par la réalité est impossible ? Vous semblez vraiment partir d'une réponse et faire matcher la réalité dans celle-ci.

Je sais pas ce qui se passe là bas. Génétique ? Mesure draconienne qui fait déscendre les morts accidentelles suffisement ? Des tests d'un pays différent ? Tous ce que je sais c'est que les vague on les même pentes sur le graph. Donc R0 similaire, c'est pas les mesures certain.

Ce n'est pas vraiment la même courbe, c'est moins abrute en monté:
(https://www.ft.com/__origami/service/image/v2/images/raw/https%3A%2F%2Fd6c748xw2pzm8.cloudfront.net%2Fprod%2Fe8e81050-b24d-11ea-869d-8350815217f5-standard.png?dpr=1&fit=scale-down&quality=highest&source=next&width=700)
Titre: Le vaccin et vous
Posté par: Wolfkiller le avril 27, 2021, 02:48:21 pm
Femme de 54 ans en pleine forme morte du Astra.

Prenez pas ça!
Titre: Le vaccin et vous
Posté par: Snookey le avril 27, 2021, 03:45:37 pm
En date d'aujourd'hui, le Québec a reçu environ 525000 doses du AZ. 1 décès sur potentiellement 525000, moi je prends ces odds-là n'importe quand.
Titre: Le vaccin et vous
Posté par: Wolfkiller le avril 27, 2021, 04:16:54 pm
Dis ça à la famille de la défunte voir si ça va les consoler.
Titre: Le vaccin et vous
Posté par: Snookey le avril 27, 2021, 05:00:46 pm
Dis ça à la famille de la défunte voir si ça va les consoler.

C'est ben plate pour eux, mais je ne vois pas en quoi leur deuil devrait influencer mon choix.
Titre: Le vaccin et vous
Posté par: Le Jam le avril 27, 2021, 05:13:27 pm
Femme de 54 ans en pleine forme morte du Astra.

Prenez pas ça!


Ça n'a juste pas de sens de présenter les choses ainsi. On aurait pu faire la litanie de personnes mortes du COVID parcequ'elles ont refusées de prendre l'AZ.

Il n'y a qu'une seule chose qui compte, la balance bénéfice/ risque et se rappeler qu'aucun,  AUCUN médicament n'est dépourvu de risque à partir du moment où il a un principe actif, même les placébos ont des effets secondaires...

Le problème c'est qu'aujourd'hui plus personne ne veut prendre l'AZ à cause de cette campagne monstrueuse qu'on  a fait à son encontre. Biensur si on donne le choix entre deux vaccin et que l'un des deux à plus d'effets secondaires que l'autre tout le monde va choisir celui qui en a le moins.
Titre: Le vaccin et vous
Posté par: Snookey le avril 27, 2021, 05:23:49 pm
"Le problème c'est qu'aujourd'hui plus personne ne veut prendre l'AZ à cause de cette campagne monstrueuse qu'on  a fait à son encontre."

Les différents gouvernements européens sont en partie à blâmer pour cette campagne.
Titre: Le vaccin et vous
Posté par: Berslak le avril 27, 2021, 06:14:15 pm
Femme de 54 ans en pleine forme morte du Astra.

Prenez pas ça!

Environ 200 fois plus de chances que ça arrive à cause de la prise de la pilule contraceptive.  Les femmes doivent arrêter de prendre la pilule aussi?

Aussi, environ 400 fois plus de chances que ça arrive à cause que la personne fume.

Et c'est même pas confirmé encore que c'est bien à cause du vaccin dans ce cas-ci.
Titre: Le vaccin et vous
Posté par: cantabile le avril 27, 2021, 06:58:43 pm
Bon la conjointe est vaccinée aussi...amenez-le votre passeport vaccinal !
Titre: Le vaccin et vous
Posté par: plsavaria le avril 27, 2021, 07:31:27 pm
Déjà reçu deux doses chaque?
Titre: Le vaccin et vous
Posté par: cantabile le avril 27, 2021, 08:38:41 pm
tu sais bien que non....pas moyen d'avoir un peu de fun !
Titre: Le vaccin et vous
Posté par: Wolfkiller le avril 27, 2021, 09:17:05 pm
Berslak est parti fou dans les -1.

Je lui ai mis un -1 pour me venger.

Titre: Le vaccin et vous
Posté par: Iluvalar le avril 28, 2021, 01:13:46 am
Celui qui fabrique, oui, car c'est ça, sa job.

Mais ya aucune idée des implications sur le corps humain du produit qu'il fabrique. Là était ma nuance.
Je se suis même pas certain qu'un pharmacien de la pharmacie du coin pourrait expliquer complètement qu'est-ce qui fait quoi là dedans.
Tu commence avec ta cellule de labo préférée. Ça a longtemps été une cellule de foie d'hamster chinois. Mais chaque labo biologue a ses propres secrets de nos jour. Ensuite t'utilise CRISPR pour modifier génétiquement la cellule. Tu lui ajoute le bout de COVID-19 qui serre de bras/poil/courone (Whatever t'as vue la photo calvaire). C'est la partie de Covid qui s'accroche à nos cellules pour les infiltrer.

Tu a maintenant une cellule de foie de hamster don't l'ADN contient un "bras" de covid. tu multiplie the billions et tu utilise un secret industriel pour dissoudre tout le reste de la cellule. Tu te retrouve rapidement avec une tonne metric de brin mRNA correspondant au "bras de covid". Tu les met dans un adjuvant (anciennement un blanc d'oeuf, mais depuis perfectionné). Qui se trouve à avoir la bonne consistance/ph/poid pour injecter dans le chaire du cobaye. Oops désolé, heureux récipiant du vaccin.

le poil de covid-19 se promène alors dans ton sang et s'attache vainement a tes cellules. À moin que ton corps bad trip et parte en trombose, eventuellement ton systeme immunitaire fini par décrocher les ordures/poils de covid. Ton corps s'occupe lui-même de produire les anti-corps pour détecter les poil de covid. Ce qui te donne un avantage inconsidérable pour te défendre contre les future mRNA qui contiennent du poil de covid.

Bravo !

Voilà, l'explication d'un bout à l'autre.
Titre: Le vaccin et vous
Posté par: cantabile le avril 28, 2021, 08:22:52 am
Faque illumachin...toi le vaccin tu laisses ça aux autres ? Ah oui et y'a pas de cas de thromboses avec le Pfizer ou le Moderna, mais bon moi j'y connais rien c'est pas mon champ d'expertise alors je laisse ça aux experts...une idée que tu devrais visiblement suivre.
Titre: Le vaccin et vous
Posté par: Lisa le avril 28, 2021, 08:22:54 am
Hé boy, je sais qu'on sais déjà que tu dis n'importe quoi, mais.


https://www.quebecscience.qc.ca/sante/comment-fonctionnent-vaccins-arn/ (https://www.quebecscience.qc.ca/sante/comment-fonctionnent-vaccins-arn/)

DÉjà en partant, pas d'adjuvant pour les vaccins COVID-19
Titre: Le vaccin et vous
Posté par: Snookey le avril 28, 2021, 10:27:15 am
Les vaccins ARN sont issue d'une technologie fascinante qui peut changer la donne pour bien des maladies :

https://www.vox.com/future-perfect/22307700/malaria-rna-vaccines-covid-19

https://www.health.harvard.edu/blog/why-are-mrna-vaccines-so-exciting-2020121021599

https://www.forbes.com/sites/victoriaforster/2021/01/11/covid-19-vaccines-cant-alter-your-dna-heres-why/?sh=3071f1ce2491


Voir l'autre épais prétendre que ces vaccins utilisent la technologie CRISPR pour modifier génétiquement les cellules, c'est du gros n'importe quoi et une autre belle preuve qu'il n'a aucune idée de quoi il parle.
Titre: Le vaccin et vous
Posté par: Lisa le avril 28, 2021, 01:23:24 pm
(https://www.cliqueduplateau.com/wordpress/wp-content/uploads/2021/04/probalitie1.jpg)
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 28, 2021, 07:21:14 pm
Hé boy, je sais qu'on sais déjà que tu dis n'importe quoi, mais.


https://www.quebecscience.qc.ca/sante/comment-fonctionnent-vaccins-arn/ (https://www.quebecscience.qc.ca/sante/comment-fonctionnent-vaccins-arn/)

DÉjà en partant, pas d'adjuvant pour les vaccins COVID-19
Oh my god NON ! J'veux l'astrazeneca ou rien ! On me modifie pas génétiquement.
Merci de me tenir au courant.

Au sujet de ton image lisa, c'est de la manipulation de données. Les gens au decus de 65 ans ont 10x plus de chance que les 55 ans. 5x plus encore pout les 75 ans et plus. ET 90% des gens on des conditions de santé agravante. Donc...
 
donc on aurait :
75ans+ avec maladie mortelle : 900 micro mort (Jusqu'à 1900 selon moi) [Edit:  "Wilkes says that’s double the micromorts compared to living on a military station in Afghanistan in 2010"  https://www.kcrw.com/news/shows/kcrw-features/risk-coronavirus-micromorts]
75ans+ sans maladie mortelles : 90 micro mort
65ans+ : 20 micromorts
Un saut de parachute : 8 micromorts
55 ans+ : 2.8 micromorts
25 ans+ : 2.3 micromorts
25ans avec maladie mortelle : 28 micromort

Le compte est bon.
Titre: Le vaccin et vous
Posté par: Ring0 le avril 29, 2021, 09:11:22 am
(https://www.cliqueduplateau.com/wordpress/wp-content/uploads/2021/04/probalitie1.jpg)

Le tableau est trompeur. Pour mourir de la covid, il faut tout d'abords attraper la covid. Donc le risque de mourir de la covid doit être multiplié par le risque de l'attraper. Le risque réel est donc plus bas.

Par exemple jusqu'à maintenant au Québec, il y a eu 8 décès covid dans le groupe des 20-29 ans. Ça donne une probabilité de mourir de la covid à ce jour d'environs 6.66/1M pour ce groupe d'âge, ce qui est plus bas que le risque de complications graves dues aux vaccins.

D'un point de vue individuel, le rapport coût/bénéfice du vaccin pour une personne de 25 ans est pas mal moins bon que pour une personne plus âgée.

Mais pour le bien de la société en général, c'est certain qu'il faut se faire vacciner lorsque c'est possible.
Titre: Le vaccin et vous
Posté par: Ring0 le avril 29, 2021, 01:37:00 pm
Bon enfin, vaccins pour tous.

Presque tout le monde autour de moi est déjà vacciné. J'ai bien hâte de l'être aussi.
Titre: Le vaccin et vous
Posté par: MadChuck le avril 29, 2021, 01:56:34 pm
Le tableau est trompeur. Pour mourir de la covid, il faut tout d'abords attraper la covid. Donc le risque de mourir de la covid doit être multiplié par le risque de l'attraper. Le risque réel est donc plus bas.

Le plus "drôle ou trompeur" c'est quand les gens prennent le risque de mourir mangé par un requin ou écraser par une machine à liqueur avec un calcul du genre (risque qui sont clairement a zéro pour les gens qui ne se baigne pas dans certaines eaux et ne shake pas de machine a liqueur), même le risque d'être frappé par la foudre est beaucoup plus grand pour un alpiniste, quelqu'un qui joue au golf ou un fermier (c'est pourquoi le nombre de gens qui se fait frappé annuellement a diminué en chute libre dans les temps modernes, les gens qui travaillent dehors sont plus rare) que la population en général.

Titre: Le vaccin et vous
Posté par: Ring0 le avril 29, 2021, 02:28:58 pm
Je ne comprend pas pourquoi ce n'est pas le PM lui-même qui annonce la vaccination pour tous ? C'est la meilleure nouvelle depuis un an et il ne l'annonce pas lui-même ? Drôle de stratégie.
Titre: Le vaccin et vous
Posté par: cantabile le avril 29, 2021, 03:45:44 pm
Effectivement, bonne observation. Je sais pas si je peux espérer avoir ma seconde dose avant la date prévue (30 juillet)
Titre: Le vaccin et vous
Posté par: Snookey le avril 29, 2021, 05:21:39 pm
Effectivement, bonne observation. Je sais pas si je peux espérer avoir ma seconde dose avant la date prévue (30 juillet)

Tu n'as pas déjà de rendez-vous pour la seconde dose ?
Titre: Le vaccin et vous
Posté par: Iluvalar le avril 29, 2021, 05:34:32 pm
Mais pour le bien de la société en général, c'est certain qu'il faut se faire vacciner lorsque c'est possible.

Non, même ça viens d'un raisonnement fautif. Ça viens de l'assomption fautive que les vagues épidémiologique sont évitables. C'était un raisonnement qu'on avaient en avril 2020 quand les gouvernement espérais encore éviter les vagues. SI les vagues sont évitable, il est "possible" qu'une personne transmette covid à 20 autres et cause une catastrophe.

Par contre, on est bien passé ce point, les variantes une après l'autre saute les océans. En partant du principe, évident à ce point, qu'on subit les vagues et ne les évites pas, le nombre d'infecté doit logiquement être égal au nombre d'infection. Donc en moyenne, chaque personne en infecte une seul autre.
Titre: Le vaccin et vous
Posté par: Emmarick007 le avril 29, 2021, 06:43:35 pm
Sérieusement. La pilule annovulant c'est de la merde. Des gens la prenne et ne se rende pas compte que la libido diminue, que les humeurs changent, que les problématiques d'endometriose augmente et je te parle meme pas des cancers.
Titre: Le vaccin et vous
Posté par: cantabile le avril 30, 2021, 06:38:45 am
Effectivement, bonne observation. Je sais pas si je peux espérer avoir ma seconde dose avant la date prévue (30 juillet)

Tu n'as pas déjà de rendez-vous pour la seconde dose ?
oui c'est bien ce que je disais...seconde dose le 30 juillet.
Titre: Le vaccin et vous
Posté par: Ring0 le avril 30, 2021, 08:21:55 am
oui c'est bien ce que je disais...seconde dose le 30 juillet.

En plein pendant tes vacances en France. Comment tu vas faire ?
Titre: Le vaccin et vous
Posté par: cantabile le avril 30, 2021, 08:50:34 am
Ce serait effectivement le cas si nous étions parti du 5 juillet au 9 août tel que prévu et planifié !
Titre: Le vaccin et vous
Posté par: Ring0 le avril 30, 2021, 09:28:37 am
Peut-être que Le Jam peut t'organiser quelque chose. Il semble bien connecté.
Titre: Le vaccin et vous
Posté par: cantabile le avril 30, 2021, 09:31:58 am
j'avais pas pensé au Jam....mais bon pas certain que ça me tente d'avoir besoin de lui.
Titre: Le vaccin et vous
Posté par: Ring0 le avril 30, 2021, 09:33:29 am
Je pense qu'il se ferait un grand plaisir de te l'injecter lui-même directement dans la fesse.
Titre: Le vaccin et vous
Posté par: cantabile le avril 30, 2021, 09:37:29 am
On va attendre qu'il vienne faire son tour dans ce fil !

Titre: Le vaccin et vous
Posté par: Iluvalar le avril 30, 2021, 03:41:37 pm
Pensez vous que les personne qui me downvote et occulte la science de cette discussion connaissent la science entourant covid ?

Ou sont-ils simplement terrifié que leur croyance sont fausse ? J'ai envie de répéter encore. En précisant une source cette fois : https://www.cdc.gov/coronavirus/2019-ncov/hcp/planning-scenarios.html

L'infographique de Lisa qui précise 800 micromort pour les les 55ans et plus et questionnable. primo parceque les risques sont 10 fois plus grand pour les 65ans et plus. Avec correction ça nous fait 80 micromort pour les gens sous 65 ans. Deuxio, n'importe qui qui comprend la vie sais qu'on subit 10 000 micromort par année. (1 million / espérance de vie) donc clairement les 800 micromort de lisa montre le 10% d'excés de mort que j'ai déja mentionné plus haut. Le compte est bon.
Titre: Le vaccin et vous
Posté par: MadChuck le avril 30, 2021, 03:59:10 pm
Pensez vous que les personne qui me downvote et occulte la science de cette discussion connaissent la science entourant covid ?

Ou sont-ils simplement terrifié que leur croyance sont fausse ? J'ai envie de répéter encore. En précisant une source cette fois : https://www.cdc.gov/coronavirus/2019-ncov/hcp/planning-scenarios.html

L'infographique de Lisa qui précise 800 micromort pour les les 55ans et plus et questionnable. primo parceque les risques sont 10 fois plus grand pour les 65ans et plus. Avec correction ça nous fait 80 micromort pour les gens sous 65 ans.

Votre source parle d'un IFR 6,000 par millions pour les 50-64 et 500 par millions pour les 18-49, ce qui rend le chiffre de 800 par millions a 55 ans assez proche. Il manque les chances d'attrape la covid dans les prochaines années si personnes se vaccines et vie normalement dans l'équation (surtout si tu l'attrape 3 fois disons, ça devient compliqué à calculer).

Votre source (Current Best Estimate) parle de 90,000 par millions comme IFR pour les 65+, ce qui est 112 fois le 800 par millions a 55.
Titre: Le vaccin et vous
Posté par: Snookey le avril 30, 2021, 05:41:41 pm
"Pensez vous que les personne qui me downvote et occulte la science de cette discussion connaissent la science entourant covid ?"

Non, on pense que tu sais pas de quoi tu parles comme tu l'as démontré à mainte et mainte reprise.
Titre: Le vaccin et vous
Posté par: dalporto le avril 30, 2021, 06:08:11 pm
Pensez vous que les personne qui me downvote et occulte la science de cette discussion connaissent la science entourant covid ?

Plus que toi.

Tu ne connais rien à la science et tu devrais arrêter d'écrire.

Tu es un imbécile et un idiot, tu n'as aucun argument qui se tient, et je n'hébergerai pas des conspirationnistes ici qui ne comprennent rien du cul ni de la tête.

À bon entendeur, salut.
Titre: Le vaccin et vous
Posté par: Splatch... le avril 30, 2021, 07:54:11 pm
Moderna en ce qui me concerne. Aucun effet secondaire. Ça va tout le monde ?
Titre: Le vaccin et vous
Posté par: Lisa le avril 30, 2021, 08:16:47 pm
heiiiiillle!

messemble qu'on parlait justement de ton expertise v'la quelques temps!

Bon retour!
Titre: Le vaccin et vous
Posté par: cantabile le avril 30, 2021, 10:11:47 pm
Hey salut Splatch !
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 01, 2021, 12:45:49 am
je n'hébergerai pas des conspirationnistes ici qui ne comprennent rien du cul ni de la tête.

À bon entendeur, salut.
Vas-y, ban moi pour mon opinion !
C'est vous les conspirationnistes. L'idée de mongole que covid pourrait tout a coup ressurgir et tuer 7 fois plus de monde... Le concept impossible que les 2 semaines de vacance de noel as encore à ce jour des effets durable sur l'épidémie.

le conspirationisme, c'est de voir CLAIRMENT 2 vagues épidémologiques et 15 mois de données et de croire que quelque part y'a un "scientifique" secret qui parle a legault et qui a une autre explication plus logique que 2 callise de vagues épidémioloques mais qu'il garde sa théorie secrète. Et juste l'accepté sans esprit critique.

C'est ben plate, mais on a eu des morts pour 3-4 saisons de grippe de plus en 15 mois. 3.88 comme dit MadChuck. Pis c'est ça qui est ça. Ton petit cerveau de primate est pas capable d'assimiler qu'on a sûrement fait 15 mois de quarantaine juste pour éviter une saison de grippe. Tu veux tellement que covid-19 sois le combat de ta vie, que t'es prêt à me bannir au lieu de regarder les choses en face.
Titre: Le vaccin et vous
Posté par: dalporto le mai 01, 2021, 08:39:27 am
Ah, juste ta yeule.
Titre: Le vaccin et vous
Posté par: cantabile le mai 01, 2021, 12:45:43 pm
Illumachin...t’es allé marcher avec tes amis ?
Titre: Le vaccin et vous
Posté par: Poune-Keuz le mai 01, 2021, 07:20:06 pm
Moderna en ce qui me concerne. Aucun effet secondaire. Ça va tout le monde ?

Salut Splatch!
Moderna pour moi également. Juste des douleurs au bras pour l’instant, on verra demain!
Titre: Le vaccin et vous
Posté par: cantabile le mai 01, 2021, 08:37:27 pm
Salut Poune, par curiosité c’est quoi le critère qui t’a donné accès au vaccin ?
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 01, 2021, 10:04:42 pm
Illumachin...t’es allé marcher avec tes amis ?
Quel amis ?

Non, j'habite un peu trop loin de montréal.
Titre: Le couvre-fou et vous
Posté par: El Kabong le mai 02, 2021, 04:02:13 pm
Ayant développé l'immunité en mars 2020, mon impression est que tous variants ne semblent pas m'atteindre.

Je n'ai rien contre des mesures sanitaires, pas de grippe ou de rhume cet hiver, pour la première fois depuis des lustres.  Par contre, le couvre-feu est une folie.  Y'a pas mal de dangereux crackheads qui se promènent après huit heures, profitant de l'absence de témoins pour perpétrer des crimes en tous genres.  Méfiez-vous!
Titre: Le vaccin et vous
Posté par: Poune-Keuz le mai 02, 2021, 07:39:38 pm
Finalement j’ai eu la totale :P Fièvre, douleurs musculaires, mal de tête, inflammation des ganglions, pu capable de bouger mon bras… mais là c’est passé! (sauf la douleur au bras mais c’est moins pire).

@canta: IMC de 35
Titre: Le vaccin et vous
Posté par: MadChuck le mai 03, 2021, 12:17:41 pm
Finalement j’ai eu la totale :P Fièvre, douleurs musculaires, mal de tête, inflammation des ganglions, pu capable de bouger mon bras… mais là c’est passé! (sauf la douleur au bras mais c’est moins pire).

Probablement bon signe que ton système a réagis et appris.
Titre: Le vaccin et vous
Posté par: Lisa le mai 03, 2021, 08:32:09 pm
J'imagine qu'on se dit aussi que si tu avais eu la vraie patente ça aurait été full force!
Titre: Le vaccin et vous
Posté par: Snookey le mai 04, 2021, 10:28:31 am
Je m'étais inscrit pour participer à l'étude clinique phase 3 du vaccin de Medicago, compagnie de Québec. J'ai reçu l'appel dimanche seulement, quelques jours après l'annonce de l'ouverture de la vaccination à tous...

Le processus est intéressant, l'étude se fait en deux phases. Première phase, deux doses dans l'espace de 21 jours, Groupe A reçoit vaccin, Groupe B reçoit placebo. Évidemment, tu ne sais pas dans quel groupe tu es. Lorsque la phase 1 est terminée, 60 jours plus tard, la phase 2 inverse les groupes, faisant en sorte que tout le monde reçoit le vaccin en deux doses. Compensation de 900$.

C'est trop peu trop tard pour moi, parce que je rencontre trop de personnes dans le cadre de mon travail et que je veux être vacciné le plus rapidement possible, alors recevoir un placebo va uniquement retarder la chose, mais pour quelqu'un qui est en télétravail la très grande majorité du temps ça devient intéressant !
Titre: Le vaccin et vous
Posté par: Ring0 le mai 04, 2021, 10:58:34 am
En fait je présume que pour produire des données intéressantes, tu veux avoir des participants qui fréquentent d'autres personnes.

Comment évaluer correctement l'efficacité du vaccin si les participants restent chez eux et ne sont pas en contact avec le virus ?
Titre: Le vaccin et vous
Posté par: Snookey le mai 04, 2021, 11:05:03 am
En fait je présume que pour produire des données intéressantes, tu veux avoir des participants qui fréquentent d'autres personnes.

Comment évaluer correctement l'efficacité du vaccin si les participants restent chez eux et ne sont pas en contact avec le virus ?

Je comprends ce que tu veux dire, mais sachant que je peux recevoir une vrai première dose très bientôt, ça ne m'intéresse pas d'attendre potentiellement 3 mois de plus.
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 04, 2021, 01:27:17 pm

Je comprends ce que tu veux dire, mais sachant que je peux recevoir une vrai première dose très bientôt, ça ne m'intéresse pas d'attendre potentiellement 3 mois de plus.
Prend le 900$ . Se faire vacciner dans 3 mois est meilleur que se faire vacciner maintenant anyway.

Regarde la science un moment : Covid-19 a au moin un R0 de 3, même durant les pathétique efforts de quarantaine qu'on a fait semblant d'essayer. Donc les vague se résorbe uniquement après avoir infecté 2/3 de la population suceptible. Et encore, covid infecte plus de personne après le pic de la vague qu'on peu appoximé à 1/6. Donc à la fin d'une vague (avec masque) y'a 5/6 des personnes suceptibles qui ont attrapé covid. On a eu 2 vague au Québec : 15 avril 2020 et 28 décembre 2020. Donc, il y'a approximativement 1/36 des personnes suceptible qui l'ont pas eu. Y'aura pas de vague cet été, la prochaine arrivera pas avant septembre 2021. Et puisque le R0 est de 3, il y a 50% de chance que tu attrape covid cette semaine là environ, disons le 21 décembre 2021. et un autrr 50% de chance, les semaines de chaque côté.

Donc tu a une chance sur 36 d'être susceptible et même là t'a peut-être 2% de chance seulement de l'attraper en plein été. Le vaccin va être carrément plus efficace dans 3 mois. Y'as des chance que je le prenne en aout ou septembre si aucun des cobayes a viré zombie d'ici là. Il y'a aucune urgence en ce moment les risques sont à 1% de la moyenne annuel. la vague est PASSÉE et nos efforts pathétiques pour la stoppé ont été vain vain vain.
Titre: Le vaccin et vous
Posté par: Snookey le mai 04, 2021, 02:51:33 pm
"Prend le 900$ . Se faire vacciner dans 3 mois est meilleur que se faire vacciner maintenant anyway."

C'est complétement faux.

Par contre, vu que t'as pas l'air pressé, je t'invite à participer à l'étude de Medicago.
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 04, 2021, 05:45:20 pm
C'est complétement faux.
Quel partie de ce que j'ai dis te parait faux ?

Le comportement de tout le groupe ici vire carrément sectaire. Êtes vous conscient qu'il y'a une différence entre la science et le fact checker de facebook ? Et qu'il y'en a un des deux plus fiable que l'autre.

Madchuck : y'a pas 200-300% de mort par année, y'a 388% depuis 15 mois !
Madchuck : y'a pas 6-8% de décès de grippe et pneumonie... non non, y'a 2.5% seulement de grippe (et 2 fois plus de pneumonie)
Lisa : Y'a ben plus que 0.08% de chance de mourrir ! y'as 800 chances sur 1 million !

C'est pas la science que vous suivez, c'est un CULTE. Ceci n'est pas la fin du monde, Covid n'est pas le combat de votre vie. C'est juste un rhume vaguement plus contagieux qu'on aurait pu le souhaiter.

Je répète mon "opinion" qui est basé 100% dans la science et le gros bon sens, que personne personne aurait contredit en 2019 : Les vaccins, dans l'hémisphère nord, c'est mieux à l'automne qu'au printemps.

T'es libre de pratiquer ton culte et chanter "c'est faux, c'est faux, c'est faux". Mais y'a absolument aucune science qui supporte l'hypothèse que ça aurait pu être pire et qu'on a éviter quoi que ce sois.

Titre: Le vaccin et vous
Posté par: Berslak le mai 04, 2021, 06:25:13 pm
On dirait un platiste qui essaie d'utiliser la science pour prouver que la terre est plate.
Titre: Le vaccin et vous
Posté par: Wolfkiller le mai 04, 2021, 06:36:53 pm
D’après Iluvalar, c’est un simple rhume qui a envoyé Benoit Pelletier dans le coma pendant 56 jours.
Titre: Le vaccin et vous
Posté par: Wolfkiller le mai 04, 2021, 07:20:16 pm
Rendez-vous pris!!!!
Titre: Le vaccin et vous
Posté par: MadChuck le mai 04, 2021, 07:25:01 pm
Madchuck : y'a pas 200-300% de mort par année, y'a 388% depuis 15 mois !

C'était très clairement sur 52 semaines.

Madchuck : y'a pas 6-8% de décès de grippe et pneumonie... non non, y'a 2.5% seulement de grippe (et 2 fois plus de pneumonie)

Quand esce que j'ai dit qu'annuellement dans un pays comme le canada il n'y pas 6 a 8% des décès qui sont causé par la grippe et les pneumonies (viral ou bactérienne réuni) ? J'en suis pas sure, vous aviez dit c'est impossible que COVID soit plus mortelle que la grippe puisqu'il y a juste 10% de morts que d'habitude, ce qui est une phrase étrange s'il y a plus de morts que d'habitude dans une années avec très peu de grippes, c'est peut-être parce que COVID est plus mortelle.


pour ce qui est de mon conditionnel si la grippe c'est environ 2.5% des morts, vu que les grippes + pneumonies si on prend la plus récente grippe très très dure de 2018,
https://www150.statcan.gc.ca/t1/tbl1/fr/tv.action?pid=1310039401
8,511 mort de grippe et pneumonie ensemble au Canada pour les 283,706 mort recensé, ou 3%
Dans une année normale comme 2017 c'est plus autour de 7 396   sur 276 689, 2.67%

Je ne suis pas sur que je suis dans le champs que ça

Lisa : Y'a ben plus que 0.08% de chance de mourrir ! y'as 800 chances sur 1 million !

Lisa n<a jamais dit ca, elle parlait qu'il ya plsu de chance de mourrir de covid pour le 55 ans moyen (800 chances par millions) que des complications du au vaccin évalué a 4 par millions pour le 55 ans moyen.
Titre: Le vaccin et vous
Posté par: dalporto le mai 04, 2021, 08:36:31 pm
Lisa : Y'a ben plus que 0.08% de chance de mourrir ! y'as 800 chances sur 1 million !


Ce qui fait 0.008%, soit....  moins de chance...

Titre: Le vaccin et vous
Posté par: dalporto le mai 04, 2021, 08:37:56 pm
On dirait un platiste qui essaie d'utiliser la science pour prouver que la terre est plate.

C'est la plus belle analogie possible.
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 05, 2021, 12:01:44 am
0.08%

C'est Les principales causes de décès Madchuck. Normalement un ainé de 75 ans avec une maladie cardiaque connu, tu fait pas d'autopsie pour voir si il avait la grippe au moment du décès. Tu coche "maladie cardiaque" et tu donne tes condoléance a la famille ou lieu de faire des tests chimiques sur le cadavre. Et le médecin sais pertinement que le patient "ne feelait pas les dernier jour". Fait les recherche.

Et ce que je dis est pourtant simple comme tout : y'a eu 300% plus de mort. Covid-19 est clairment très infectueux, donc il a très clairement infecté plus de personne. Si il y a 3 fois plus de mort et que il y'a eu 3x plus d'infections, c'est que inviduelement le risque est autour de 100% (une maladie respiratoir normal, disons 115%).

Lisa a dis qu'on est resté à la maison, et qu'on a perdu nos job parce qu'on a eu 0.08% plus de chance de mourir cette année. Il lui reste a démontrer qu'on en aurait eu plus sans intervention gouvernemental. Mais ça regarde mal parce logiquement passé 1% de notre vie en dedans pour éviter 0.08% de chance de mourir, c'est pas exactement ce qu'on appel un urgence nationale.

D’après Iluvalar, c’est un simple rhume qui a envoyé Benoit Pelletier dans le coma pendant 56 jours.
https://www.lung.org/getmedia/98f088b5-3fd7-4c43-a490-ba8f4747bd4d/pi-trend-report.pdf

les maladies respiratoire peuvent effectivement tuer plus qu'on y pense. Et le profil des ages est très similaire à Covid-19. Quand je dis que c'est "juste' un rhume, faut quand même bien assimiler que je parle de 2-3 millions de morts en moyenne par année. (3 fois plus cet année)
Titre: Le vaccin et vous
Posté par: MadChuck le mai 05, 2021, 12:38:01 am
0.08%
C'est Les principales causes de décès Madchuck. Normalement un ainé de 75 ans avec une maladie cardiaque connu, tu fait pas d'autopsie pour voir si il avait la grippe au moment du décès. Tu coche "maladie cardiaque" et tu donne tes condoléance a la famille ou lieu de faire des tests chimiques sur le cadavre. Et le médecin sais pertinement que le patient "ne feelait pas les dernier jour". Fait les recherche.

Vous prenez trop de raccourci, c'est quoi 0.08% dans ce paragraphe ? Et effectivement la grippe c'est estimer avec la surmortalité durant quelle est active et d'autre calcul je pense, pas des autoposie parce que mourir de la grippe et mourrir avec la grippe est pas toujours une distinction évidente de toute façon.

Et ce que je dis est pourtant simple comme tout : y'a eu 300% plus de mort. Covid-19 est clairment très infectueux, donc il a très clairement infecté plus de personne. Si il y a 3 fois plus de mort et que il y'a eu 3x plus d'infections, c'est que inviduelement le risque est autour
de 100% (une maladie respiratoir normal, disons 115%).

Vous sauter des mots et dites des choses trop simple, y'a pas eu 300% plus de mort (ce serait une catastrophe) il y eu avec 8 mois sur 12 de pandémie 300% plus de mort d'infection du genre grippe et pneumonie que sur une année (malgré l'absence de grippe), vous partez avec votre réponse, il y a eu beaucoup moins d'infection au covid que de maladie respiratoire (les gens attrape en moyenne plus d'un rhume-grippe par année). Il n'y pas clairement plus de gens infecté parce que c'est très infectieux, SARS 1 était très infectieux, y'a eu très peu de gens qui l'ont eu grâce aux mesures, c'est à démontrer cette affirmation.

Lisa a dis qu'on est resté à la maison, et qu'on a perdu nos job parce qu'on a eu 0.08% plus de chance de mourir cette année. Il lui reste a démontrer qu'on en aurait eu plus sans intervention gouvernemental. Mais ça regarde mal parce logiquement passé 1% de notre vie en dedans pour éviter 0.08% de chance de mourir, c'est pas exactement ce qu'on appel un urgence nationale.

Quoter ce message, moi je parlais de celui ou elle simplement montrait les changes estimer de mourrir de complication a la suite d'une vaccination pour quelqu'un de 55 ans versus les chances estimer pour quelqu'un de 55 ans de mourrir de COVID s'il l'attrape. Le on ici est un peu intense, certaines population avait plus de 30% de chance de mourrir de COVID et d'autre virtuellement aucune. j'ai jamais vu le IFR global d'une population aussi bas que 0.08%.
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 05, 2021, 06:54:08 pm
Madchuck, combien de test de séroprévalence il vous faut ? 10 ? 100 ? 1000 ?
https://covid.cdc.gov/covid-data-tracker/?CDC_AA_refVal=https%3A%2F%2Fwww.cdc.gov%2Fcoronavirus%2F2019-ncov%2Fcases-updates%2Fcommercial-labs-interactive-serology-dashboard.html#national-lab

Covid a AU MINIMUM infecté 20% des américains probablement 33%. Le virus est clairement capable de tripler les infections en 2 mois. Les différente variantes, les unes après les autres deviennent pandémic, malgré les quarantaine, malgré les masques, malgré la planète entière consciente du virus.

Et pas juste les humains, les lions, tigre, les gorille, les chauve souris, les rats de labo. "research shows that many mammals, including cats, dogs, bank voles, ferrets, fruit bats, hamsters, mink, pigs, rabbits, racoon dogs, tree shrews, and white-tailed deer can be infected with the virus." https://www.cdc.gov/coronavirus/2019-ncov/daily-life-coping/animals.html

Appellez-moi conspirationiste, mais j'vais suggerer que tout les mamifères de la planète sont infectable (et +20% infectés).

Compte tenu qu'on trouve covid dans 20% des prises de sang de la planète, je maintien que OUI la propagation a été particulièrement violente les derniers deux ans.

Résumé : Y'as eu 10% de surmortalité l'année passée, l'équivalent de ~3 saisons de pneumonie. On aura perdu 6 mois d'espérance de vie. C'est triste, j'essaie pas de rien minimser, mais il y'a des montagnes d'évidence que c'est pas mal ça qui est ça.
Titre: Le vaccin et vous
Posté par: MadChuck le mai 06, 2021, 02:16:41 pm
Covid a AU MINIMUM infecté 20% des américains probablement 33%.

Et tu penses que c'est 3 fois plus que le nombre de gens qui attrapent une grippe ou un rhume au cours d'une année ?

https://www.cdc.gov/dotw/common-cold/index.html
Each year in the United States, millions of people get the common cold. Adults have an average of 2-3 colds per year, and children have even more.
Pour la grippe c'est 5 à 20% des gens, 10% à 25% au Canada selon les années.

Il y a peu de signe (aucun que j'ai vu) que COVID a infecté plus de gens que toute les maladies infectieuses du genre dans une année normale, encore moins 3 fois plus.

Citer
Résumé : Y'as eu 10% de surmortalité l'année passée, l'équivalent de ~3 saisons de pneumonie. On aura perdu 6 mois d'espérance de vie. C'est triste, j'essaie pas de rien minimiser, mais il y'a des montagnes d'évidence que c'est pas mal ça qui est ça.

Oui (ou 7% au canada je pense), la n'est pas tellement le débat je pense, ce qui est débattue c'est si ce 7-10% du Canada-États-Unis aurait le même si on avait vécu nos vie normalement, continuer a aller au centre-bell, avoir les gens avec des symptômes qui vont au travail et prennent des métros bondé et ainsi de suite, si on avait tous pogné ça soit en avril soit en novembre-décembre et vécu parmis les survivants.

Au mexique les mortalités excessive durant les premiers 12 mois de la pandémie sont dans les 400,000, au mexique dans les 9 premieres semaine de 2020 il y avait eu 138,788 morts dans les 9 premières semaines de 2021 il y a eu 278,346 morts
https://coronavirus.gob.mx/exceso-de-mortalidad-en-mexico/

Dans le 52 semaines entre la semaine 11 de 2020 et la semaine 9 de 2021, au Mexique normalement il y a environ 734,500 morts, ils en on eu 1,190,373 morts, soit 62% de plus qu'à l'habitude durant cette période de 1 ans.

L'âge médian au Mexique est de 29.2 ans, beaucoup plus jeune qu'au Canada (41.1) ou aux états-unis de 38 ans, seulement 7.8% de la population Mexicain serait âgé de 65 ans et plus au Canada c'est le double a 15.6%, ils n'ont pas tellement d'hiver.

Pourquoi le Canada semble faire incroyablement mieux (presque 10 fois mieux en pourcentage de surmortalité) ? Accès a de meilleur soins, accès possible si ce n'est pas trop débordé et si les soins on eu le temps d'augmenté avec les connaissances (aux états-unis maintenant certains ainées qui ont covid reçoivent le même traitement que Trump a reçu, s'il l'attrape en avril-mai 2020 ils n'ont pas les mêmes traitements), seulement 10-15% de la population qui a eu covid (si on se fit aux états-unis ou il y a beaucoup plus de mort par capita qu'au Canada) au lieu des 60-70%+ que l'on voit ailleur (https://www.india.com/news/india/nearly-70-people-infected-with-covid-19-in-rural-india-national-sero-survey-4138016/) ?

Alors que dans les villes ce n'était que dans les 14-15% au même moment.

Jamais vous comparez dans votre analyse un endroit qui l'échappe avec un endroit plus en contrôle, vous construisez une petites listes de pays très similaire avec des réponses très similaires pour conclure que celle-ci ne change rien (ce qui est déjà étrange en soit il faudrait des pays dans les lesquels il y a eu zero changement de comportement comme référence) au lieu de regarder plus de 100 pays et y voir un échantillons de surmortalités qui vont de -4-5% a des situations ou il y a 50%+ de morts qu'a l'habitude.

Ça ne prouve pas que les mesures change quelque chose en soit bien sur, génétiques, variants et autre facteurs peuvent être la, mais les pays aux meilleures réponses, les pays dont les réponses ont commencé en 2019 et non pas en 2020 semble mieux s'en sortir que les pays avec les réponses en retard, les endroit qui s'ont des îles sans accès en voiture (comme Hawaii aux États-Unis) semble mieux s'en sortir et ainsi de suite.
Titre: Le vaccin et vous
Posté par: dalporto le mai 06, 2021, 02:32:44 pm
Je suis vacciné.

End of story.
Titre: Le vaccin et vous
Posté par: Wolfkiller le mai 06, 2021, 02:52:24 pm
As-tu déjà la date pour la deuxième dose?
Titre: Le vaccin et vous
Posté par: Ring0 le mai 06, 2021, 03:07:10 pm
Crime que vous êtes vieux.
Titre: Le vaccin et vous
Posté par: Ring0 le mai 06, 2021, 03:07:28 pm
Je suis vacciné.

End of story.

Il te l'as-tu rentré ?
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 06, 2021, 03:08:48 pm
Jamais vous comparez dans votre analyse un endroit qui l'échappe avec un endroit plus en contrôle, vous construisez une petites listes de pays très similaire avec des réponses très similaires pour conclure que ...
au Mexique normalement il y a environ 734,500 morts
mexico Population: 127.6 million
morts pas année : 734,500
Espérance de vie (pop/mort/année) :  173 ans. Ajustement pour la pyramid des ages (70/100) = 121 ans....

Conclusion logique : Les morts au mexique sont typiquement sous reporté.

mexico Population: 127.6 million
Morts cette année : 1,190,373 morts
Espérance de vie : 107 ans (ajustement * 70/100 ) = 75.05 ans. (AH ! beaucoup mieux)
https://www.macrotrends.net/countries/MEX/mexico/life-expectancy#:~:text=The%20life%20expectancy%20for%20Mexico,a%200.01%25%20increase%20from%202017.

Conclusion logique : le mexique compte bien ses morts cette année. Bravo pour le progrès !
Conclusion illogique : y'a 63% plus de mort cette année ! AAAAAAH !


Et c'est pourquoi je focus mes efforts sur les pays industrialisés. Parcequ'ils ont des données nettement plus fiables que le vietnam. Et le fait qu'ils se ressemblent tous en dis long.
Titre: Le vaccin et vous
Posté par: MadChuck le mai 06, 2021, 03:42:45 pm
Et c'est pourquoi je focus mes efforts sur les pays industrialisés. Parcequ'ils ont des données nettement plus fiables que le vietnam. Et le fait qu'ils se ressemblent tous en dis long.

Le petites groupe que vous regardez qui exclut la Norvège, Finlande, Japon, Corée du Sud, Australie, Nouvelle Zélande qui ne ressemble pas a la France, UK, États-Unis, Italie, Belgique

mexico Population: 127.6 million
morts pas année : 734,500
Espérance de vie (pop/mort/année) :  173 ans. Ajustement pour la pyramid des ages (70/100) = 121 ans....

La population du Mexique a doubler depuis 1977 et pas par immigration, je ne pense pas que pouvez calculer l'espérance de vie de la sorte pour une population a l'âge médian sous les 30 ans qui avait près de 7 enfants par femme en moyenne dans les année 70. Ou au moins expliquer votre calcul pour la pyramide des ages (vous sauter toujours des étapes en ne mettant que des chiffre pourquoi 70/100 au juste ?)

Il y a 2 fois moins de personne âgé par capita au Mexique qu'au Canada et malgré cela 76% des morts par capita.

Regarder un endroit comme Singapour
Titre: Le vaccin et vous
Posté par: dalporto le mai 06, 2021, 03:59:34 pm
As-tu déjà la date pour la deuxième dose?

Oui.  26 août.
Titre: Le vaccin et vous
Posté par: dalporto le mai 06, 2021, 04:00:13 pm
Je suis vacciné.

End of story.

Il te l'as-tu rentré ?

Je suis trop vieux pour comprendre la question.
Titre: Le vaccin et vous
Posté par: Ring0 le mai 06, 2021, 04:42:01 pm
Non non, tu es drette dans le bon âge.
Titre: Le vaccin et vous
Posté par: dalporto le mai 06, 2021, 06:24:51 pm
Je dirais François Pérusse?
Titre: Le vaccin et vous
Posté par: Berslak le mai 06, 2021, 11:39:07 pm
Je dirais François Pérusse?

Me surprendrait car je la comprend pas moi non plus.
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 06, 2021, 11:52:57 pm
(vous sauter toujours des étapes en ne mettant que des chiffre pourquoi 70/100 au juste ?)
70 #Esperance de vie moyenne a la naissance
100 #Année de vie engendré par procréation (120 dans les pays ou le pyramide est encore pyramidal)

70/100 =
(https://upload.wikimedia.org/wikipedia/commons/d/d7/Total_Fertility_Rate_Map_by_Country.svg)
Divisé par 2.
Titre: Le vaccin et vous
Posté par: Ring0 le mai 07, 2021, 07:56:22 am
Je dirais François Pérusse?

Me surprendrait car je la comprend pas moi non plus.


https://www.youtube.com/watch?v=NRxD6850Xc4
Titre: Le vaccin et vous
Posté par: dalporto le mai 07, 2021, 08:05:41 am
J'ai cherché un boutte mais ça ne me revenais crissement pas.
Titre: Le vaccin et vous
Posté par: Ring0 le mai 07, 2021, 09:38:31 am
Oui mais t'as pas répondu à la question.
Titre: Le vaccin et vous
Posté par: dalporto le mai 07, 2021, 09:43:16 am
Bin, évidemment.
Titre: Le vaccin et vous
Posté par: MadChuck le mai 07, 2021, 02:43:20 pm
70 #Esperance de vie moyenne a la naissance

L'espérance de vie du mexique est de 76.66 ans

100 #Année de vie engendré par procréation (120 dans les pays ou le pyramide est encore pyramidal)

Je ne comprend pas se chiffre (pourquoi 100 au mexique et pourquoi 120 ailleur, vous ne faite que l'affirmer et ça n'explique pas pourquoi le 70 / 100), pourquoi une procréation engendre 100 années de vie ? J'imagine que ça prend en compte les enfants de l'enfant engendré par la procréation, ce qui fait que 100 ans semble peu.

Et pourquoi le mexique n'est pas dans les pays qui est encore pyramidale:
(https://upload.wikimedia.org/wikipedia/commons/thumb/a/a7/Mexico_single_age_population_pyramid_2020.png/350px-Mexico_single_age_population_pyramid_2020.png)

?
https://upload.wikimedia.org/wikipedia/commons/d/d7/Total_Fertility_Rate_Map_by_Country.svg

Pourquoi me montrer une carte de la fertilité des pays (sans me dire que c'était ça) quand on parle de l'espérance de vie et mortalité ?

et 70/100 donne 0.7, le mexique selon votre carte a un taux de fertilité entre 2 et 2.2 enfant par femme (il était de 2.117 en 2019), si je le divise par deux je n'arrive pas à 0.7 alors je ne comprend pas le signe = entre 70/100 et la carte que vous avez mis. Si en 2021 le mexique a la moitié des enfants qu'a son habitude ou double ça ne changeras pas grand chose au nombre de morts n 2021 il me semble.

Encore une fois vous avez sauté toute les étapes explicative et ne mettez que les chiffres.
Titre: Le vaccin et vous
Posté par: Wolfkiller le mai 07, 2021, 05:20:55 pm
Ces débats sont futiles, on tous être vaccinés bientôt.
Titre: Le vaccin et vous
Posté par: Wolfkiller le mai 07, 2021, 06:48:36 pm
*va
Titre: Le vaccin et vous
Posté par: plsavaria le mai 07, 2021, 07:49:06 pm
2e dose de Moderna mardi prochain, quelques heures après la fin de ma quarantaine, et réception de résultat de test négatif plus tôt aujourd'hui.
Je ne devrais pas, par la suite, ravoir à retourner en quarantaine au prochain transport prolongé de client positif. Yay.
Titre: Le vaccin et vous
Posté par: cantabile le mai 07, 2021, 11:33:08 pm
Vous êtes plus rapides que nous sur la seconde dose au Manitoba ! Mon espoir c’est de convaincre une infirmière de me donner la mienne quand ils viendront vaccinner les élèves !
Titre: Le vaccin et vous
Posté par: plsavaria le mai 08, 2021, 12:43:04 am
C'est pas tant la province qui est rapide (mais pareil plus que le Québec), que les réserves locale recevant leurs doses d'Ottawa, qui en ont au final davantage que la demande (ouvert aux 18+, mais l'intérêt est pas si élevé pour les plus jeunes).
Titre: Le vaccin et vous
Posté par: cantabile le mai 09, 2021, 07:07:27 pm
Bon je viens de m'injecter mon nouveau médicament à 950$ la dose...dommage que je puisse  pas le faire avec Pfizer !
Titre: Le vaccin et vous
Posté par: dalporto le mai 09, 2021, 08:16:05 pm
????
Titre: Le vaccin et vous
Posté par: Lisa le mai 09, 2021, 10:02:22 pm
Tu l'injectes où?
Titre: Le vaccin et vous
Posté par: Gilbert Du Motier le mai 09, 2021, 10:27:29 pm
Je suis vacciné.

End of story.

Moi j’attends, pour faire pression en faveur du passeport vaccinal.

Je veux qu’ils paient les tabarnaks! En restriction, et en détresse respiratoire.

Aussitôt qu’ils annnocent le passeport, je m’inscris.

Bye. Je ne répondrai a aucune question, et je vais revenir, peut-être un moment donné.
Titre: Le vaccin et vous
Posté par: cantabile le mai 10, 2021, 08:02:33 am
Tu l'injectes où?
ventre ou cuisse...
Titre: Le vaccin et vous
Posté par: Snookey le mai 10, 2021, 08:03:38 am
@Pontiak : C'est niaiseux en maudit ça...
Titre: Le vaccin et vous
Posté par: dalporto le mai 10, 2021, 08:06:14 am
Tu l'injectes où?
ventre ou cuisse...

De quoi tu parles?
Titre: Le vaccin et vous
Posté par: cantabile le mai 10, 2021, 09:28:15 am
Je parle de ma hâte de recevoir ma seconde dose....
Titre: Le vaccin et vous
Posté par: Snookey le mai 10, 2021, 06:38:29 pm
Je parle de ma hâte de recevoir ma seconde dose....

Mais, eux se demande de quel nouveau médicament que tu parles ?
Titre: Le vaccin et vous
Posté par: cantabile le mai 10, 2021, 08:10:22 pm
Ah...Humira.
Titre: Le vaccin et vous
Posté par: Berslak le mai 10, 2021, 08:47:20 pm
Ah...Humira.

Je te souhaite que ça fonctionne bien contre ta maladie!
Titre: Le vaccin et vous
Posté par: cantabile le mai 10, 2021, 10:22:44 pm
Ah...Humira.

Je te souhaite que ça fonctionne bien contre ta maladie!
merci, je le souhaite aussi parce qu'après ça les options sont peu nombreuses !
Titre: Le vaccin et vous
Posté par: dalporto le mai 10, 2021, 10:37:05 pm
Ok, je comprends fuck all, mais bonne chance!
Titre: Le vaccin et vous
Posté par: dalporto le mai 11, 2021, 08:04:32 am
Ma mère prenait de l'hydrochloromachin pour ça.

Grâce à gros cave Trump, elle a passée quelque mois sans pouvoir en avoir.
Titre: Le vaccin et vous
Posté par: cantabile le mai 11, 2021, 09:40:16 am
Je sais que c'était pas clair mon affaire.... Je trouvais juste un brin ironique d'avoir envie d'un injection vaccinale que je ne peux pas avoir tout en m'injectant moi-même un coûteux médicament dont j'aimerais bien pouvoir me passer.

Je me souviens que tu avais parlé du cas de ta mère....je ne sais pas ce qu'elle a, mais moi je suis traité pour une spondylarthrite ankylosante ainsi qu'une maladie de Crohn.
Titre: Le vaccin et vous
Posté par: dalporto le mai 11, 2021, 10:16:36 am
Ça sonne pas le fun.
Titre: Le vaccin et vous
Posté par: MadChuck le mai 11, 2021, 12:35:00 pm
Ça sonne comme la situation à Simon Leblanc, ça médication coûte autour de 35,000 par année
Titre: Le vaccin et vous
Posté par: cantabile le mai 11, 2021, 02:11:00 pm
Après une rapide rechercge
Ça sonne comme la situation à Simon Leblanc, ça médication coûte autour de 35,000 par année
Après une rapide recherche je confirme qu'on a exactement la même situation médicale...eh ben ! Mon traitement devrait être autour de 25 000$ par année.
Titre: Le vaccin et vous
Posté par: Le Jam le mai 12, 2021, 01:39:27 pm
Si tout va bien j'aurais ma première injection de Pfizer vendredi, hâte de pouvoir enfincapter la 5G !
Titre: Le vaccin et vous
Posté par: Wolfkiller le mai 12, 2021, 02:55:02 pm
Moi aussi c'est vendredi  :smiley41:
Titre: Le vaccin et vous
Posté par: MadChuck le mai 12, 2021, 03:23:01 pm
Je suis maintenant Moderné !
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 12, 2021, 04:40:55 pm
Je suis maintenant Moderné !
Yay, retour à la sience du 17e siècle !  :smiley36:
Titre: Le vaccin et vous
Posté par: Snookey le mai 12, 2021, 06:02:49 pm
Si tout va bien j'aurais ma première injection de Pfizer vendredi, hâte de pouvoir enfincapter la 5G !

Pareil, vendredi !
Titre: Le vaccin et vous
Posté par: cantabile le mai 12, 2021, 07:06:43 pm
Bravo la gang ! Belle solidarité !
Titre: Le vaccin et vous
Posté par: dalporto le mai 13, 2021, 07:34:12 am
Me faire répondre des affaires comme ça par un gars qui vendait (et consommait) de la poudre:

"C vrai que les vaccins c d la marde.y a je sais pas combien de mort dans l monde Ben a cause du vaccin.si toe tu est assez naïf pour croire et te faire injecter un liquide experimental ds l bras ben go,mais si moe j en veut pasde ton vaccin c est mon affaire.ok?"
Titre: Le vaccin et vous
Posté par: Le Jam le mai 13, 2021, 08:50:20 am
Me faire répondre des affaires comme ça par un gars qui vendait (et consommait) de la poudre:

"C vrai que les vaccins c d la marde.y a je sais pas combien de mort dans l monde Ben a cause du vaccin.si toe tu est assez naïf pour croire et te faire injecter un liquide experimental ds l bras ben go,mais si moe j en veut pasde ton vaccin c est mon affaire.ok?"

Bel exemple de Darwinisme appliqué.
Titre: Le vaccin et vous
Posté par: Ring0 le mai 13, 2021, 10:24:15 am
Bel exemple de Darwinisme appliqué.

En fait pas vraiment, la covid-19 étant très peu dangereuse pour les gens étant en âge de se reproduire (et les plus jeunes évidemment).
Titre: Le vaccin et vous
Posté par: sharl le mai 13, 2021, 11:24:59 am
maladie de Crohn.

Tu parles d'une maladie dégueux!

"Douleur abdominale, fièvre, fatigue, anorexie, sensation d'évacuation incomplète des selles , diarrhée, amaigrissement, constipation, fistule, arthralgie, aphte, ulcère."
Titre: Le vaccin et vous
Posté par: cantabile le mai 13, 2021, 12:20:13 pm
J'aimerais bien maigrir....mais je reste un petit gros malgré ça ! Et c'est effectivement pas super jojo comme maladie.
Titre: Le vaccin et vous
Posté par: Simone le mai 13, 2021, 01:14:47 pm
Je suis maintenant Moderné !

Oh! Je ne connaissais personne qui avait eu Moderna encore. Je me sens privilégiée 😅

J'ai eu Pfizer-Biontech pour ma part, et je suis une cliente satisfaite. D'abord, le fait d'être vaccinée m'a mise dans une humeur excellente comme je n'en avais pas connue depuis des mois, puis quand les effets secondaires ont kické in, j'ai été affectée par une sensation de lourdeur généralisée qui me donnait l'impression de me déplacer dans une combinaison anti-gravité, ce que j'ai fait, laborieusement mais hilare, pendant environ une heure avant de sombrer dans un sommeil également lourd qui m'a permis de dormir ma première nuit de 10h en cinq ans (moins deux semaines). C'était fa-bu-leux.
Titre: Le vaccin et vous
Posté par: plsavaria le mai 13, 2021, 01:55:24 pm
Ma 2e dose m'a affecté vraiment plus au lendemain (hier) que la 1ere.
Pas avoir été en jour off, j'aurais peut être même pensé prendre un congé maladie.
Mais au réveil aujourd'hui, de retour à la normale (après nuit so-so).
#team moderné
Titre: Le vaccin et vous
Posté par: Le Jam le mai 13, 2021, 02:12:29 pm
Je me vaccine demain, j'espère ne pas être trop secoué car je prend la route le lendemain !
Titre: Le vaccin et vous
Posté par: MadChuck le mai 13, 2021, 02:12:46 pm
Ma 2e dose m'a affecté vraiment plus au lendemain (hier) que la 1ere.
Pas avoir été en jour off, j'aurais peut être même pensé prendre un congé maladie.
Mais au réveil aujourd'hui, de retour à la normale (après nuit so-so).
#team moderné

Pour avoir une idée, la première t'avais telle affecté plus qu'un sensation au bras à l'endroit de la piqûre ?
Titre: Le vaccin et vous
Posté par: Lisa le mai 13, 2021, 02:46:19 pm
Apparemment que AZ c'est la 1ere de 2 qui est plus rough, et Pfizer/Moderna la 2e. On conseille effectivement de prévoir un jour off le lendemain.
Titre: Le vaccin et vous
Posté par: Le Jam le mai 13, 2021, 02:47:12 pm
1er et deuxième injection le vendredi, malin !
Titre: Le vaccin et vous
Posté par: plsavaria le mai 13, 2021, 02:50:11 pm
Moi non, femme un peu plus (equivalent douleur gros bleu sur épaule, pouvait pas dormir sur ce côté après 1ere dose).
Elle n'a pas travaillé hier (fièvre, douleurs musculaires) , correct aujourd'hui (2e dose mardi soir).
Titre: Le vaccin et vous
Posté par: emsi le mai 13, 2021, 03:54:29 pm
Je suis maintenant Moderné !

team moderna!  :smiley41:
Titre: Le vaccin et vous
Posté par: Wolfkiller le mai 13, 2021, 04:35:37 pm
On peut-tu boire beaucoup d’alcool après l’injection?
Titre: Le vaccin et vous
Posté par: plsavaria le mai 13, 2021, 05:15:47 pm
On peut-tu boire beaucoup d’alcool après l’injection?

Je vois pas ce qui t'empêcherait physiquement de boire beaucoup.
Mais taxer son système quand on le taxe déjà, c'est pas trop gagnant.

Aussi, il n'y a aucune période d'exclusion pour don de sang suivant vaccination covid, si quelqu'un veut vraiment s'aligner à avoir un lendemain difficile!
Titre: Le vaccin et vous
Posté par: Wolfkiller le mai 13, 2021, 06:09:24 pm
J’vais voir si j’ai des side effects (autres qu’une douleur au bras) et si tout va bien: Big Peat!!!
Titre: Le vaccin et vous
Posté par: Jean Lapierre le mai 13, 2021, 10:28:40 pm
J'ai eu Pfizer y a une dizaine de jours. Zéro effet secondaire, j'ai même joggé sans problème le soir même.
Mais il paraît que le deuxième Pfizer fesse davantage. Ce qui est quand même chiant pour les pauvres qui ont eu AZ (rough première dose) et qui auront Pfizer en deuxième dose. Le pire de deux mondes!
Titre: Le vaccin et vous
Posté par: dalporto le mai 14, 2021, 08:15:23 am
Est-ce qu'il y a une différence de composition ou de quantité entre les deux doses ou c'est une question de réponse immunitaire?
Titre: Le vaccin et vous
Posté par: Lisa le mai 14, 2021, 08:20:02 am
Je pense que c'est vraiment réponse immunitaire. Genre la première fois tu lis le protocole en cas d'alerte de feu et la deuxième fois c'est la pratique d'incendie.
Titre: Le vaccin et vous
Posté par: Le Jam le mai 14, 2021, 08:58:22 am
Ça y est j'ai eu officiellement ma première dose, aucun problème à date !
Titre: Le vaccin et vous
Posté par: Wolfkiller le mai 14, 2021, 05:06:51 pm
Pfizerizé baby!

Titre: Le vaccin et vous
Posté par: Wolfkiller le mai 14, 2021, 05:09:28 pm
Aucun effet secondaire à date.
Titre: Le vaccin et vous
Posté par: cantabile le mai 14, 2021, 05:37:13 pm
Ça veut dire que le vaccin n'est pas efficace sur toi.
Titre: Le vaccin et vous
Posté par: Snookey le mai 14, 2021, 05:41:51 pm
Aucun effet secondaire à date.

Ah !

Attend.

Moi ça va mais je sens que je vais être raqué du bras gauche demain!
Titre: Le vaccin et vous
Posté par: Wolfkiller le mai 14, 2021, 05:54:04 pm
Mon dernier vaccin remonte au secondaire, et j’me souviens avoir eu mal au bras par la suite, mais là rien du tout.

Le gars qui m’a vacciné est un acupuncteur de profession, et un métaleux. On a pris une photo ensemble pour la postérité :D
Titre: Le vaccin et vous
Posté par: Wolfkiller le mai 14, 2021, 09:09:50 pm
Aucun effet secondaire à date.

Ah !

Attend.

Moi ça va mais je sens que je vais être raqué du bras gauche demain!

Yup, t’avais raison, mon épaule fait mal (zuss un peu).
Titre: Le vaccin et vous
Posté par: Lisa le mai 14, 2021, 09:10:31 pm
Mon dernier vaccin remonte au secondaire, et j’me souviens avoir eu mal au bras par la suite, mais là rien du tout.

Le gars qui m’a vacciné est un acupuncteur de profession, et un métaleux. On a pris une photo ensemble pour la postérité :D

Haha, celui avec les cheveux super longs?
Titre: Le vaccin et vous
Posté par: Wolfkiller le mai 14, 2021, 09:13:29 pm
Oui!! Le gars qui ne clignait pas des yeux!
Titre: Le vaccin et vous
Posté par: Lisa le mai 14, 2021, 09:27:56 pm
haha, ma collègue me le décrivait justement hier ! :D

EDIT: Elle me disait a quel point il était pas stressé, et elle non plus sachant qu'il etait acupuncteur.
Titre: Le vaccin et vous
Posté par: Wolfkiller le mai 14, 2021, 10:20:07 pm
Je dois dire par contre que je n’ai vraiment pas apprécié qu’on demande à tout l’monde à l’entrée d’enlever leurs masques pour en mettre un autre. J’ai fait un p’tit tantrum.
Titre: Le vaccin et vous
Posté par: Fouinard le mai 14, 2021, 11:00:11 pm
Je dois dire par contre que je n’ai vraiment pas apprécié qu’on demande à tout l’monde à l’entrée d’enlever leurs masques pour en mettre un autre. J’ai fait un p’tit tantrum.
Tu ne vas pas souvent dans un centre hospitalier. C'est une activité quotidienne pour ceux et celles qui y travaillent!
Titre: Le vaccin et vous
Posté par: Wolfkiller le mai 14, 2021, 11:53:57 pm
Explique-moi la logique de me faire enlever un masque pour en mettre un autre.
Titre: Le vaccin et vous
Posté par: Lisa le mai 15, 2021, 06:29:20 am
S'assurer que tu as un masque et non un couvre-visage. S'assurer que tu n'as pas dépassé ton 4h de port avec ce masque si tu portes déjà un masque bleu.
Titre: Le vaccin et vous
Posté par: cantabile le mai 15, 2021, 10:45:50 am
Wolf et ses crises du bacon inutiles.
Titre: Le vaccin et vous
Posté par: Wolfkiller le mai 15, 2021, 01:30:29 pm
Pendant que je m’obstinais j’ai entendu quelqu’un derrière moi souffler “bon, un autre complotiste”.

Haha!
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 15, 2021, 03:23:44 pm
le masque est juste là pour t'empêcher de postilloner sur le monde et te rappeller que t'es hypochondriac. Covid est une molecule, si l'oxygène de rend jusqu'à tes poumons, les chances sont énormes que covid passe ton masque aussi.

Si tu respire calmement par le nez pendant que tu change de masque, tu va être OK lol.
Titre: Le vaccin et vous
Posté par: Fouinard le mai 15, 2021, 04:06:20 pm
le masque est juste là pour t'empêcher de postilloner sur le monde et te rappeller que t'es hypochondriac. Covid est une molecule, si l'oxygène de rend jusqu'à tes poumons, les chances sont énormes que covid passe ton masque aussi.

Si tu respire calmement par le nez pendant que tu change de masque, tu va être OK lol.
Rarement lu autant de connerie au mot carré.  :smiley36:'COVID est une molécule'  :smiley36: Non, c'est une maladie kriss de cruche!  :smiley8: :smiley40:
Titre: Le vaccin et vous
Posté par: exademine le mai 15, 2021, 07:29:43 pm
Oh! Je ne connaissais personne qui avait eu Moderna encore. Je me sens privilégiée 😅

J'ai eu Pfizer-Biontech pour ma part, et je suis une cliente satisfaite. D'abord, le fait d'être vaccinée m'a mise dans une humeur excellente comme je n'en avais pas connue depuis des mois, puis quand les effets secondaires ont kické in, j'ai été affectée par une sensation de lourdeur généralisée qui me donnait l'impression de me déplacer dans une combinaison anti-gravité, ce que j'ai fait, laborieusement mais hilare, pendant environ une heure avant de sombrer dans un sommeil également lourd qui m'a permis de dormir ma première nuit de 10h en cinq ans (moins deux semaines). C'était fa-bu-leux.

Ça me donne beaucoup d'anticipation pour ma dose de demain. 10h de sommeil ça serait la meilleure chose.
Titre: Le vaccin et vous
Posté par: Lisa le mai 15, 2021, 08:59:46 pm
Le sommeil est difficile ces temps-ci?
Titre: Le vaccin et vous
Posté par: Snookey le mai 15, 2021, 11:35:46 pm
Aucun effet secondaire à date.

Ah !

Attend.

Moi ça va mais je sens que je vais être raqué du bras gauche demain!

Yup, t’avais raison, mon épaule fait mal (zuss un peu).

J'ai très peu dormi la nuit passée parce que je dors habituellement de côté sur mon épaule piquée, mais à part le mal à l'épaule, aucun autre effet secondaire !
Titre: Le vaccin et vous
Posté par: MadChuck le mai 16, 2021, 12:09:10 pm
Je dois dire par contre que je n’ai vraiment pas apprécié qu’on demande à tout l’monde à l’entrée d’enlever leurs masques pour en mettre un autre. J’ai fait un p’tit tantrum.

J'avais un beau KN-95 a enveloppe unique que j'ai changer pour un petite masque cheap et j'ai eu un petit, "mais mon meilleur masque" dans ma tête, pour ensuite pensé qu'il en veulent un neuf non contaminé.

Covid est une molecule, si l'oxygène de rend jusqu'à tes poumons, les chances sont énormes que covid passe ton masque aussi.

C'est triste pour le système public Québécois d'éducation de ton époque.

Covid est une maladie, causé par le virus SARS?CoV?2

Un virus est évidemment pas une molécule, un petit virus est composé de plusieurs millions de molécules et gros par des milliards. SARS-COV-2 est composé de 200 millions d'atomes, une molécule d'eau de 3 atomes, les molécules d'oxygènes O2 de 2 atomes.

Sars-cov2:
Diameter: ?100 nm
Volume: ~10^6 nm3 = 10^-3 fL
Mass: ~10^3 MDa ? 1 fg

Molecule d'eau:
Diameter: 0.27 nm (soit environ 50 millions de foi plus petit que le virus je pense en volume)


Titre: Le vaccin et vous
Posté par: Iluvalar le mai 16, 2021, 04:34:47 pm
Sars-cov2:
Diameter: ?100 nm
Volume: ~10^6 nm3 = 10^-3 fL
Mass: ~10^3 MDa ? 1 fg
un Masque N95 par définition bloque 95% de particules de 300nm. Il ne bloque donc PAS les particules de 100nm. Ça c'est en suposant que covid a besoin de son capside une fois a l'intérieur du masque.

Faite tous un test simple : Appuyer le masque contre votre bouche et respirez AU TRAVERS du matériel. Si c'est plus difficile que lorsque vous respirer normalement avec le masque, c'est que l'air circule librement autour du masque.

Tout ce que le masque fait c'est vous empecher de cracher sur le monde ou leur souffler dans la face. C'est tout...
Titre: Le vaccin et vous
Posté par: dalporto le mai 16, 2021, 04:51:14 pm
Les virus est toujours accroché après quelque chose de plus gros imbécile.

Arrêtes-tu de venir raconter ta marde ici?
Titre: Le vaccin et vous
Posté par: Snookey le mai 16, 2021, 04:52:18 pm
À quel point on est chanceux sur le Forum d'avoir accès à un expert en toute, Iluvalar !
Titre: Le vaccin et vous
Posté par: Fouinard le mai 16, 2021, 05:48:56 pm
Illuvatar, le seul mec sur terre qui trouve le moyen de fausser avec un gazou!
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 17, 2021, 02:01:36 am
Les virus est toujours accroché après quelque chose de plus gros imbécile.

Arrêtes-tu de venir raconter ta marde ici?
Non. Le MASQUE n'arrête pas les aérosol. On sais maintenant qu'une partie des infections, (30-85*%?), se fait par aérosol. Il y a amplement d'études peer-reviewed sur le sujet. Les masques ont un effet sur le Rt d'au max .1-.3/[3-5]. On va pouvoir le calculer dans le Rt du 21 juin. Sauf qu'on pouvais le calculer dans le Rt du 21 juin 2020.
Titre: Le vaccin et vous
Posté par: Berslak le mai 17, 2021, 09:46:22 am
Les virus est toujours accroché après quelque chose de plus gros imbécile.

Arrêtes-tu de venir raconter ta marde ici?
Non. Le MASQUE n'arrête pas les aérosol. On sais maintenant qu'une partie des infections, (30-85*%?), se fait par aérosol. Il y a amplement d'études peer-reviewed sur le sujet. Les masques ont un effet sur le Rt d'au max .1-.3/[3-5]. On va pouvoir le calculer dans le Rt du 21 juin. Sauf qu'on pouvais le calculer dans le Rt du 21 juin 2020.

 :smiley29:

Un aérosol, c'est le quelque chose (de très fines gouttelettes) après lequel le virus peut s'accrocher, chose.

Le virus n'est pas l'aérosol lui-même voyons.
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 17, 2021, 09:52:13 pm
Un aérosol, c'est le quelque chose (de très fines gouttelettes) après lequel le virus peut s'accrocher, chose.

Le virus n'est pas l'aérosol lui-même voyons.
https://first10em.com/covid-19-is-spread-by-aerosols-an-evidence-review/

Un aérosol en terme epidémiologique est une particule qui peux rester dans les airs pendants des jours. Comme la fumée d'une cigarette, l'humidité dans notre souffle. L'air qui sort par les côté de ton masque ne retombe pas toujours au sol la même journée. Et Sars-coV2, au sec, dans hors de la lumière du soleil, a une demi-vie de 20 heure. Le masque t'empêche juste grossomodo de cracher sur la personne d'en face. À moins de 2m, ça on l'a tous compris. Mais la partie aérosol de la transmission est aussi une partie connue, quoique difficile a quantifier.

(https://lh4.googleusercontent.com/fo_vQQch3IhvQk9Dhj6mAsrk9-n6wremgVu5ZpMEtuZ3YRb9MZwZWqlYN1B91M1Lvfj5TLZ0HcJKbUCPWr4GVoEAVl-URO7bJbZ0gU9hG_H4lZH7EMYs6otiz0FIg3JQs25PSRAD)
Titre: Le vaccin et vous
Posté par: MadChuck le mai 17, 2021, 10:41:18 pm
Un aérosol en terme epidémiologique est une particule qui peux rester dans les airs pendants des jours. Comme la fumée d'une cigarette, l'humidité dans notre souffle. L'air qui sort par les côté de ton masque ne retombe pas toujours au sol la même journée. Et Sars-coV2, au sec, dans hors de la lumière du soleil, a une demi-vie de 20 heure.

Et ce n'est pas le virus lui même, c'est une micro goutelle, qui contient des virus:


A guideline to limit indoor airborne transmission of COVID-19
https://www.pnas.org/content/118/17/e2018995118

When the person is infectious, these droplets of sputum are potentially pathogen bearing, and represent the principle vector of disease transmission. The range of the exhaled pathogens is determined by the radii of the carrier droplets, which typically lie in the range of 0.1 ?m to 1 mm. While the majority are submicron in scale, the drop size distribution depends on the form of exhalation event (11). For normal breathing, the drop radii vary between 0.1 and 5.0 ?m, with a peak around 0.5 ?m

I.e. la plupart des aerosol sont plus gros que 300nm (mais pas tous, mais évidemment la quantité de covid auquel est exposé est important, c,est pas un 1 ou 0)


Droplets and aerosols: An artificial dichotomy in respiratory virus transmission
https://onlinelibrary.wiley.com/doi/full/10.1002/hsr2.275

Pour ce qui est d'une demi vie de 20 heure (pour un virus assez sains pour infecter les gens) en aérosol ça me semble énorme:
https://www.dhs.gov/science-and-technology/sars-airborne-calculator

Dans les etudes avec la grippe et SARS 1, les masques semblait avoir le plus grand des effets (versus se laver les mains)

Par exemple cette études:
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5705692/

3,591 employées d'hôpitaux en Chine, 4 groupe créer au hasard,

1) premier groupe va toujours porter des N95
2) deuxième groupe va porter des N95 pour les manipulations, rencontre les plus dangereuse
3) Utiliser des masques médicaux
4) contrôle

Conclusion
The results suggest that the classification of infections into droplet versus airborne transmission is an oversimplification. Most guidelines recommend masks for infections spread by droplets. N95 respirators, as “airborne precautions,” provide superior protection for droplet?transmitted infections. To ensure the occupational health and safety of healthcare worker, the superiority of respirators in preventing respiratory infections should be reflected in infection control guidelines.

Pour ce qui est des infections viral respiratoire comme influenza, les gens qui portait en permanence le N95 avait beaucoup moins d'infection que le groupe sans masque
Titre: Le vaccin et vous
Posté par: Lisa le mai 18, 2021, 11:03:44 am
Puis les portes et les fenêtres sont ouvertes partout depuis janvier dans les écoles... c'est pas pour rien.
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 19, 2021, 01:42:55 pm

I.e. la plupart des aerosol sont plus gros que 300nm (mais pas tous, mais évidemment la quantité de covid auquel est exposé est important, c,est pas un 1 ou 0)
Tu t'écoute pas parler. Ces goutellette là (pas aerosol), ne vont pas plus loin que 1.5m en face de nous. BIEN ÉVIDEMMENT, si c'était le vecteur principal de Covid-19, on aurait un impact, visible, direct et décisif sur le virus. Si les masque arrêtaient la majorité des infections, le Rt de covid aurait été de 0.5 et moins le 21 juin.

Citer
Droplets and aerosols: An artificial dichotomy in respiratory virus transmission
https://onlinelibrary.wiley.com/doi/full/10.1002/hsr2.275
CONCLUSION :
Citer
The work reviewed here suggests that the range and duration in which airborne droplets pose a significant infection risk for influenza A and SARS-CoV-2 may have been significantly underestimated. As a consequence, recommendations on the use of N95 or surgical masks or on spatial separation should be continuously reviewed in light of the emerging findings on the biophysics of airborne droplets.
lis tes sourcs.


Citer
Pour ce qui est d'une demi vie de 20 heure (pour un virus assez sains pour infecter les gens) en aérosol ça me semble énorme:
https://www.dhs.gov/science-and-technology/sars-airborne-calculator
prend le calculateur, met 0 UV light, 72 et 73 et le plus bas taux d'humidité. Pis reviens me dire ce que tu lis sur le calculateur.

Citer
Dans les etudes avec la grippe et SARS 1, les masques semblait avoir le plus grand des effets (versus se laver les mains)

Par exemple cette études:
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5705692/

3,591 employées d'hôpitaux en Chine, 4 groupe créer au hasard,

1) premier groupe va toujours porter des N95
2) deuxième groupe va porter des N95 pour les manipulations, rencontre les plus dangereuse
3) Utiliser des masques médicaux
4) contrôle

Conclusion
The results suggest that the classification of infections into droplet versus airborne transmission is an oversimplification. Most guidelines recommend masks for infections spread by droplets. N95 respirators, as “airborne precautions,” provide superior protection for droplet?transmitted infections. To ensure the occupational health and safety of healthcare worker, the superiority of respirators in preventing respiratory infections should be reflected in infection control guidelines.

Pour ce qui est des infections viral respiratoire comme influenza, les gens qui portait en permanence le N95 avait beaucoup moins d'infection que le groupe sans masque
Lis la source encore... prend le temps... les masques N95 protègent à ~50%, les autres masques non.

Toute tes sources me donnent raison madchuck  :smiley36:
Titre: Le vaccin et vous
Posté par: MadChuck le mai 19, 2021, 02:06:38 pm
lis tes sourcs.

Et ? Ils ne dit pas qu'ils servent a rien, si tu lis c'est très clair qu'ils disent, que vu que la distinctione entre gouttelette et aérosol est exagéré, c'est pas clair qu'un masque ordinaire fait autant l'affaire qu'un de type N95 parce que ce n'est pas juste une question de goutellete, pas que ceux-ci ne servent à rien (ce qui n'est pas dis dans le bout que tu cite du tout d'ailleur).


Lis la source encore... prend le temps... les masques N95 protègent à ~50%, les autres masques non.
Toute tes sources me donnent raison madchuck

Si un N95 protègent à 50%, ton affirmation de départ sur lequel on s'obtiennent était que si l'oxygène passe, un virus peux passer donc le masque procure aucune protection semble complètement fausse. Tu es d'accord que c'était faux ?, parce que je peux respirer dans mon KN95.

Et tous les masques ont protégé contre les infections virales respiratoires:
(https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5705692/bin/IRV-11-511-g001.jpg)

Variables in the model   Relative risk (95% CI)   P?value
Continuous N95 arm   0.46 (0.23?0.91)   .026
Targeted N95 arm   0.70 (0.30?1.67)   .424
Medical mask arm   0.78 (0.39?1.56)   .484
Control arm   Ref   Ref

Le p-value est haut pour les masques ordinaire donc ils aimerait un plus gros échantillions, mais 22% moins de gens ont eu une infection virale respiratoire chez les porteur de masques médicaux. Pour influenza c'était 66% moins chez les N95 et 45% de moins avec les masques médicaux.


prend le calculateur, met 0 UV light, 72 et 73 et le plus bas taux d'humidité. Pis reviens me dire ce que tu lis sur le calculateur.

J'ai 36 heures, mais il ne fait jamais aussi sec à l'intérieur, même dans l'air climatisé, quand c'est vraiment bas avec le déshumidicateur dans le tapis tu es dans les 35-40 non ? Ce qui est autour de 45-60 minutes.
Titre: Le vaccin et vous
Posté par: Gilbert Du Motier le mai 19, 2021, 02:28:48 pm
Le N95 filtre physiquement 95% du "in" si bien ajusté, a .3 microns. On disait que Covid était a .5 microns. Donc il ne passe pas le filtre.

Mais étant un corps gras, je crois que c'est R95 qu'il fallait.

J'avais que du respirateur P100 qui lui, en multi-couche, a du charbon, donc peu importe le premier filtre, corps gras ou non.

Ca prend un facial complet pour les yeux.

L'idée de quelconque masque ou filtre, est de réduire le risque a un niveau acceptable par rapport a la menace. Autrement, en labo, il vont y aller avec un habit en pression positive...etc.

Le masque permet de s'exposer plus, le respirateur permet une proximité quasi totale, l'habit en pression positive d'une source externe peut te permettre d'en vaporiser partout a zéro risque.

On a choisi la lingette ffp2 pour contrôler le "out" et limiter la contamination de l'environnement immédiat, et se permettre d'avoir une contamination raisonnable qui permet a la société de fonctionner a un risque relativement bas. Question de se nourrir et d'avoir de l'électricité pendant que la science solutionne et neutralise  le problème a la source.

C'est très bien.
Titre: Le vaccin et vous
Posté par: Lisa le mai 20, 2021, 10:59:29 pm
https://science.sciencemag.org/content/early/2021/05/19/science.abg6296

Abstract
Airborne transmission by droplets and aerosols is important for the spread of viruses. Face masks are a well-established preventive measure, but their effectiveness for mitigating SARS-CoV-2 transmission is still under debate. We show that variations in mask efficacy can be explained by different regimes of virus abundance and related to population-average infection probability and reproduction number. For SARS-CoV-2, the viral load of infectious individuals can vary by orders of magnitude. We find that most environments and contacts are under conditions of low virus abundance (virus-limited) where surgical masks are effective at preventing virus spread. More advanced masks and other protective equipment are required in potentially virus-rich indoor environments including medical centers and hospitals. Masks are particularly effective in combination with other preventive measures like ventilation and distancing.
Titre: Le vaccin et vous
Posté par: Cinéphile IV le mai 20, 2021, 11:10:31 pm
AstraZeneca

Le lendemain matin en me levant je me sentais comme Rocky au lendemain de son combat contre Drago. Rendu à 10h j'étais en plein forme.

Deuxième dose à la mi-août
Titre: Le vaccin et vous
Posté par: Gros Bidule le mai 20, 2021, 11:41:06 pm
Paraît que la deuxième dose va frapper fort.
Titre: Le vaccin et vous
Posté par: Lisa le mai 21, 2021, 08:24:51 am
la deuxième de Pfizer et Moderna. Pour AZ, c'est souvent la première la pire.
Titre: Le vaccin et vous
Posté par: cantabile le mai 21, 2021, 08:36:58 am
Si y'a une.personne qui a un truc pour que je puisse avoir la seconde dose plus vite je suis preneur !
Titre: Le vaccin et vous
Posté par: Lisa le mai 21, 2021, 08:44:45 am
Je vais me renseigner quand je vais commencer. Si tu vas via clic santé, ils te laissent tu t'inscrire plus tôt?
Titre: Le vaccin et vous
Posté par: Ring0 le mai 21, 2021, 08:47:54 am
Si y'a une.personne qui a un truc pour que je puisse avoir la seconde dose plus vite je suis preneur !

(https://i.imgur.com/9lEMtnKh.jpg)
Titre: Le vaccin et vous
Posté par: cantabile le mai 21, 2021, 09:14:02 am
Ouin, mais perdre 2 semaines de salaire ...bof.
Titre: Le vaccin et vous
Posté par: Snookey le mai 21, 2021, 09:17:07 am
Si y'a une.personne qui a un truc pour que je puisse avoir la seconde dose plus vite je suis preneur !

Es-tu immunosupprimé ? Si oui, tu peux avoir accès à ta 2e dose il me semble.
Titre: Le vaccin et vous
Posté par: cantabile le mai 21, 2021, 09:30:37 am
Si y'a une.personne qui a un truc pour que je puisse avoir la seconde dose plus vite je suis preneur !

Es-tu immunosupprimé ? Si oui, tu peux avoir accès à ta 2e dose il me semble.
c'esr vraiment pas aussi simple, c'est pour les gens "fortement" immunosupprimés.
Titre: Le vaccin et vous
Posté par: Ring0 le mai 21, 2021, 10:21:22 am
Ouin, mais perdre 2 semaines de salaire ...bof.

C'est une question intéressante.

Combien serais-tu prêt a payer pour avoir une dose de vaccin ?
Titre: Le vaccin et vous
Posté par: dalporto le mai 21, 2021, 12:38:27 pm
My first-born son.
Titre: Le vaccin et vous
Posté par: Gros Bidule le mai 21, 2021, 02:39:55 pm
So let it be written, so let it be done
Titre: Le vaccin et vous
Posté par: dalporto le mai 21, 2021, 03:53:38 pm
I'm creeping death.
Titre: Le vaccin et vous
Posté par: cantabile le mai 21, 2021, 04:44:36 pm
Ouin, mais perdre 2 semaines de salaire ...bof.

C'est une question intéressante.

Combien serais-tu prêt a payer pour avoir une dose de vaccin ?
ça dépend de ce que me permet de faire cette seconde dose de vaccin...entre 0$ et 1000$ je dirais.
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 22, 2021, 03:35:40 pm
https://science.sciencemag.org/content/early/2021/05/19/science.abg6296

Abstract
Face masks are a well-established preventive measure, but their effectiveness for mitigating SARS-CoV-2 transmission is still under debate.
c'est une façon poli de dire qu'il n'y a pas de raison de croire que les masque de cotton son suffisant.

C'est ça la clé que j'essaie tranquillement de vous faire réaliser...

Oui les masque de cotton bloquent ~50% des dropplets qui constituent 15-85% des infections pendant le 4h/24h qu'on les portent. Soyons stupidement optimiste et imaginons, qu'on ne mange pas, qu'on bois pas et qu'on entre pas en contact avec aucune surface jamais... Dans ce cas les masques pourraient arrêter jusqu'a 30% des infections.

Ça change rien au fait qu'on peux mesure le R0 de covid AVEC les masques facilement en analysant les vagues. Il a un R0 d'au moins 3 AVEC les mesures.

Les mesures qu'on a prisent était donc complétement insuffisantes. Même pas proche. Et donc la majorité des personnes qui étaient susceptibles aux variantes locales de Covid ont été infecté. La prochaine vague sera hiver 2021-2022.

Par aillieur, y'aurais absolument aucune raison que les vaccins fonctionne mieux qu'une infection pour protéger les gens. Puisque c'est la même proteine dans les deux cas. Donc la demi-vie du vaccin sera pas térrible non-plus, je calcule ~56 jours. Le bon moment pour un vaccin c'est en Septembre-Octobre. Le Rt de covid, va être 1 en juin.
Titre: Le vaccin et vous
Posté par: cantabile le mai 22, 2021, 04:30:29 pm
Être un grand spécialiste de l'immunologie et écrire comme une marde.
Titre: Le vaccin et vous
Posté par: sharl le mai 22, 2021, 08:52:58 pm
À vrai dire les gens portent le masque surtout par obligation (pour ne pas se faire interpeler ou foudroyer du regard) et non pour se protéger car si c'était pour cette raison ils le porteraient correctement et en prendraient soin ce qui est loin d'être le cas.
Titre: Le vaccin et vous
Posté par: Snookey le mai 22, 2021, 09:28:38 pm
À vrai dire les gens portent le masque surtout par obligation (pour ne pas se faire interpeler ou foudroyer du regard) et non pour se protéger car si c'était pour cette raison ils le porteraient correctement et en prendraient soin ce qui est loin d'être le cas.

C'est drôle, ce que tu décris est quelque chose que je remarque surtout chez les gens de ton âge !
Titre: Le vaccin et vous
Posté par: Cinéphile IV le mai 23, 2021, 09:32:18 am
la deuxième de Pfizer et Moderna. Pour AZ, c'est souvent la première la pire.

Tant mieux si c'est le cas, mais j'aurais pas de problème à revivre la même chose (trois heures su'l cul) si c'est ce qui faut.
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 24, 2021, 05:19:31 pm
si c'est ce qui faut.
Faux, tu va le prendre comme un mouton brainwashé même si t'en a pas besoin.

Même si on t'explique par A+B que 75% de vaccinés nécéssaire = vague inévitable = déja passée = Ouain, c'était pas si pire...

Tu va quand même te fier aveuglément a l'intelligence artificiel de facebook, qui se base sur toutes les histoire d'épidémie fictives jamais écrites et les lobby américains.
Titre: Le vaccin et vous
Posté par: Cinéphile IV le mai 24, 2021, 06:16:01 pm
Qu'est-ce que Facebook vient faire là-dedans?
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 24, 2021, 11:43:57 pm
Qu'est-ce que Facebook vient faire là-dedans?
Tu sais pas ? Autour du mois d'avril ou mai 2020, pendant la vague a new-york, Le scénario le plus optimiste sur covid ont dépasser l'infuenza. "les scientifiques confirment, Covid-19 est pire que l'influenza...". Ce jour là, big tech a entrainé son AI pour détecter les post qui parlent des scénarios optimiste entourant covid.

Ceux-ci sont automatiquement taggé comme de la désinformation et "démoté" pour apparaitre plus loin, ou pas du tout dans les feed.

https://techcrunch.com/2020/03/16/facebook-reddit-google-linkedin-microsoft-twitter-and-youtube-issue-joint-statement-on-misinformation/

Un scientifique, ou une chaine de nouvelle, qui voudrais dire que Covid-19 est environ 3 fois plus dangereux que l'influenza, serait censuré automatiquement. Ou faire une comparaison rationnelle entre le taux de mortalité des deux virus. Quiconque essaie se fait censurer par les bots de bigtech.

Et comme covid n'as jamais été SI mauvais que ça, et qu'il est toujours sommes toute comparable à 3 saisons de grippe en une, nous n'entendons absoluement pas parlé des scénarios optimistes à propos de covid. À moins que tu fasse de vrai recherches toi même, ça n'arriveras jamais dans ton feed.

Gpt-3, l'intelligence artificielle d'open AI a lu tout les livres disponnibles en format numérique. Y compris tout les livres et film de science fiction apocalyptique. C'est a cette intelligence artificielle là qu'on a consciemment demander de censurer les scénario trop moumoune.

Titre: Le vaccin et vous
Posté par: Cinéphile IV le mai 25, 2021, 12:27:57 am
Tu sais pas ?

Parce que toi "tu sais"?

La vérité c'est que t'as passé un an à poster 3-4 messages par semaine avec zéro impact, et ce, sur la plateforme de discussion la moins influente du Québec.

Faut avoir du temps à perdre en cibole...
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 25, 2021, 02:15:45 pm
Parce que toi "tu sais"?
J'viens de donner le lien de l'annonce conjointe de big tech.
La voici encore sur twitter :
https://twitter.com/fbnewsroom/status/1239703497479614466?ref_src=twsrc%5Etfw%7Ctwcamp%5Etweetembed%7Ctwterm%5E1239703497479614466%7Ctwgr%5E%7Ctwcon%5Es1_&ref_url=https%3A%2F%2Ftechcrunch.com%2F2020%2F03%2F16%2Ffacebook-reddit-google-linkedin-microsoft-twitter-and-youtube-issue-joint-statement-on-misinformation%2F


Edit: https://tech.fb.com/vaccine-confidence/
Titre: Le vaccin et vous
Posté par: MadChuck le mai 25, 2021, 03:33:16 pm
Par aillieur, y'aurais absolument aucune raison que les vaccins fonctionne mieux qu'une infection pour protéger les gens. Puisque c'est la même proteine dans les deux cas. Donc la demi-vie du vaccin sera pas térrible non-plus, je calcule ~56 jours. Le bon moment pour un vaccin c'est en Septembre-Octobre. Le Rt de covid, va être 1 en juin.

Un vaccin maintenant veut dire le booster en septembre-octobre ce qui en fait je pense un non débat ?

Et pas besoin de se poser la question plus qu'il faut y'a des gens qui se sont fait vacciner il y a quand même longtemps durant les premières études:

(https://www.nejm.org/na101/home/literatum/publisher/mms/journals/content/nejm/0/nejm.ahead-of-print/nejmc2103916/20210512/images/img_xlarge/nejmc2103916_f1.jpeg)
https://www.nejm.org/doi/full/10.1056/nejmc2103916

Although the antibody titers and assays that best correlate with vaccine efficacy are not currently known, antibodies that were elicited by mRNA-1273 persisted through 6 months after the second dose, as detected by three distinct serologic assays. Ongoing studies are monitoring immune responses beyond 6 months as well as determining the effect of a booster dose to extend the duration and breadth of activity against emerging viral variants. Our data show antibody persistence and thus support the use of this vaccine in addressing the Covid-19 pandemic.

Il semblerait (selon les graphique si haut) que 170 jours après ton boost l'immunité est encore beaucoup plus grande que 4 semaine après ta première doses (qui est déjà très grande 2 semaine apres la premiere dose), 170 jours après ton booster du premier septembre te fait traverser tous l'hiver sans problème et bien mieux que traversé l'hivers avec juste ta première dose j'ai l'impression. A voir ses courbes il faudrait pas se surprendre si une bonne immunité dure plus de 300 jours.

Par aillieur, y'aurais absolument aucune raison que les vaccins fonctionne mieux qu'une infection pour protéger les gens.

il y a une raison qui me semble évidente, les variants, ça dépend des virus pour certains les vaccins sont mieux, pour d'autre la route naturelle est meilleur ou égal, pour le moment il semblerait que le taux réinfection après avoir eu covid est plus grand que le taux d'infection chez les vaccinés, mais dans le group des pré-infectés covid contient plsu de gens prédisposé a l'avoir et moins de gens avec une grande résistance naturelle on peut imaginer, c'est pas quelque chose qui est automatique et que l'on peut savoir apparement:

vaccines for some pathogens, like pneumococcal bacteria, induce better immunity than the natural infection does. Early evidence suggests that the Covid-19 vaccines may fall into this category. Volunteers who received the Moderna shot had more antibodies — one marker of immune response — in their blood than did people who had been sick with Covid-19.

In other cases, however, a natural infection is more powerful than a vaccine. For example, having mumps — which can, in rare cases, cause fertility problems in men — generates lifelong immunity, but some people who have received one or two doses of the vaccine still get the disease.

To Mr. Paul’s point: Natural immunity from the coronavirus is fortunately quite strong. A vast majority of people infected produce at least some antibodies and immune cells that can fight off the infection. And the evidence so far suggests that this protection will persist for years, preventing serious illness, if not reinfection.

But there is a “massive dynamic range” in that immune response, with a 200-fold difference in antibody levels.

In people who are only mildly ill, the immune protection that can prevent a second infection may wane within a few months. “Those people might benefit more from the vaccine than others would,” said Bill Hanage, an epidemiologist at the Harvard T.H. Chan School of Public Health.


https://www.medpagetoday.com/blogs/marty-makary/92434

En passant vous etes passe de:
Le taux de reproduction(R0) de covid est d'environ 2.38 a maintenant:
Il a un R0 d'au moins 3 AVEC les mesures.

R0 de 3 avec les mesures, 96% du Québec le pogne après les 3 premiers mois je pense et si l'infection naturelle est aussi bonne que 2 doses de vaccins et dure plus de 6 mois.....
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 25, 2021, 05:51:21 pm
En passant vous etes passe de:
Le taux de reproduction(R0) de covid est d'environ 2.38 a maintenant:
Il a un R0 d'au moins 3 AVEC les mesures.
J'ai calculé pendant la vague le Rt à 2.38.
Le R0 est au moment 0.
C'est normal que le Rt change, on se dirige vers un Rt de 1 le 21 juin.
C'est troublant qu'après t'avoir enseigné comment calculer le Rt trois fois, tu doute encore de la science...


R0 de 3 avec les mesures, 96% du Québec le pogne après les 3 premiers mois je pense et si l'infection naturelle est aussi bonne que 2 doses de vaccins et dure plus de 6 mois.....
non, 84% des Québécois susceptibles l'ont effectivement pogné en 3-4 mois. Tel que témoigne les deux vagues qu'on a eu qui ont chacune fait 5700 morts. Le 16% restant est protégé par l'immunité collective durant les mois d'été puisqu'on se dirige (comme pas magie  :smiley29:) vers un Rt de 1 au soltice d'été. Comme il l'as été durant l'été 2020.

Pour le reste :
Quand je dis que la demi-vie des anticorps est de ~56 jours (calculé moi même), ce n'est pas contradictoire du tout avec l'affirmation "les niveaux d'anticorps sont détectables jusqu'à 6 mois après le vaccin". Il va quand même vous falloir une dose en septembre-octobre, avant la saison de grippe.

Et quand je dis que les vaccins ne sont pas testé, je ne parle pas de la résistance à covid-19. Je parle des risques de cancer, de dérèglement hormonal, dérèglement mental et blabla... qui n'ont jamais été testé pour la proteine en question.

Vous vous injectez une proteine alienne pour vous vacciner contre la grippe pour le mois de juillet. Allumez ma bande de bozo ! y'a pas de saison de grippe en juillet. Le gouvernement est incompétent. c'est sécuritaire dehors depuis fébvrier.

Titre: Le vaccin et vous
Posté par: Fouinard le mai 25, 2021, 06:26:55 pm
Se faire traiter de bozo par un con qui prétend que la COVID est une molécule! :smiley36: :smiley40: :smiley8:
Titre: Le vaccin et vous
Posté par: MadChuck le mai 25, 2021, 08:29:14 pm
En passant vous etes passe de:
Le taux de reproduction(R0) de covid est d'environ 2.38 a maintenant:
Il a un R0 d'au moins 3 AVEC les mesures.
J'ai calculé pendant la vague le Rt à 2.38.
Le R0 est au moment 0.

Et je vous ai littéralement cité, vous aviez clairement dit R0 de 2.38 non pas RT:
Bon, ce qui suis quand même devrait être des math de secondaire 5. Sentez vous a l'aise de vérifier.

Le taux de reproduction(R0) de covid est d'environ 2.38. C'est a dire qu'à tout les ~12 jours ou une personne est infectée, elle va en moyenne en contaminer 2.38 autres. Bien sûr, le virus n'iras pas infecter les marsiens une fois qu'il ne va rester que 1/2.38 de la population à infecter chaque personne infecté ne pourra plus infecter plus qu'une persone non-infecté par cycle puisque tout les autres l'auront déja eu. À ce moment là le taux de reprodution (Rt) est de 1.

Pris le temps de lancé un sujet sur cette base et bien fait la différence entre R0 et RT dans le même paragraphe ce n'était pas parce que vous ne faissiez pas la différence a l'époque, vous pouvez voir ici:
https://forumdupeuple.com/index.php?topic=1788.msg329669;topicseen#new

RT peut jamais être plus grand que R0 bien évidemment, c'est le RT qui bouge et vous avez dit a l'époque quand ça faisait vos affaire de calculer un RT dans les 1.5-1.7 ou je ne sais trop et dire que le R0 n'était que de 2.3-2.4 et que les mesures ne font pas grand chose, maintenant on parle de quoi d'un R0 autour de 3.5 ?

Les Québécois ont eu en moyenne covid 1.6 fois, mais personne dans ma famille a peu près personne sur ce forum la eu et on a eu beaucoup moins d'excès de morts qu'au états-unis malgré une population plus vieille.
 
Les excès de mortalité Québécois:

semaine du 14 mars 2020 au 6 juin 2020: 4,449
semaine du 13 juin 2020 au 5 septembre 2020: 74
semaine du 12 septembre 2020 au 5 décembre 2020: 1,413
semaine du 12 décembre 2020 à celle du 6 mars 2021: 924

6,860 au total pour 8,45 millions d'habitant, 80 par 100,000



Titre: Le vaccin et vous
Posté par: Iluvalar le mai 25, 2021, 10:15:22 pm
2.38-3.0 ?
Le CDC donne entre 2 et 4 (~2.5): https://www.cdc.gov/coronavirus/2019-ncov/hcp/planning-scenarios.html

Le 3 octobre, mon objectif était de prouver que les mesures étaient INSUFISANTES et que la vague allait arriver. J'ai donc utilisé le R0 le plus optimiste possible pour démontrer le MINIMUM de mesure supplémentaire qu'il fallait prendre pour avoir une chance d'éviter la vague.

Aujourd'hui 25 mai, la vague que j'ai prédis c'est produite. Et mon objectif est de prouver que même dans le pire des cas, nous avons subit la majorité des morts possibles. D'où l'idée de prende le pire R0 possible.

Aussi, avec le recul, je constate que les deux vagues étaient de taille similaire, je m'attendais è bien pire. Il y' avait donc probablement un fond de personnes immunisé (~10%) de l'année passé sous le Rx de 2.38 que j'avais calculé cette journée là.

2-3 . Ça change rien è mes arguments. Si ça t'amuse refait les maths avec les R0 qui m'avantage plus.


Edit pour ne pas double poster:
Se faire traiter de bozo par un con qui prétend que la COVID est une molécule! :smiley36: :smiley40: :smiley8:
Yep, un seul brin d'ARN dont le code complet est : MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQ
                     HLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGE
                     TLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQEN
                     WNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQ
                     LDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFP
                     LNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQTG
                     DFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESG
                     LKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNL
                     LEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGN
                     FKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAA
                     ITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKL
                     KPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLV
                     NKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEII
                     FLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEK
                     YCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEK
                     CSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEF
                     KLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPE
                     EEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSG
                     YLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESD
                     DYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLA
                     PLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIA
                     EIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGN
                     LHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV
                     PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREM
                     LAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLIN
                     TLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSS
                     KTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVIT
                     FDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPH
                     NSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIK
                     WADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELG
                     DVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQ
                     IPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSK
                     ETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYY
                     KKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVT
                     FFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWST
                     KPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGD
                     IILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNS
                     VPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRI
                     KASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTA
                     ALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLET
                     IQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWL
                     MWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVE
                     CTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRP
                     INPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPI
                     NVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVN
                     TFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVEC
                     LKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALI
                     WNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWL
                     KQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFA
                     NKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLP
                     RVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVA
                     YESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSG
                     RWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL
                     AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTN
                     DVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFE
                     EAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHL
                     AKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNG
                     LWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVL
                     KLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSC
                     GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVN
                     VLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAV
                     LDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHW
                     LLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFL
                     LPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTAR
                     TVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLAR
                     GIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYL
                     VSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVL
                     LSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKL
                     CEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAK
                     SEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALN
                     NIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDA
                     DSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTA
                     CTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTP
                     KGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAK
                     AYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDH
                     PNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSA
                     DAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKD
                     EDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQR
                     LTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYA
                     NLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVV
                     DSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQ
                     TYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRE
                     LGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQ
                     TVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDI
                     RQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQ
                     DALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAAT
                     RGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLAR
                     KHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQ
                     AVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMM
                     ILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCS
                     QHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKH
                     PNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTV
                     LQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCD
                     VTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDW
                     TNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKP
                     RPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSH
                     TVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGK
                     SHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKF
                     KVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQ
                     LPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLK
                     AHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNA
                     VASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSD
                     RDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT
                     EGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEG
                     CHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIP
                     LMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCL
                     CDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNA
                     HVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLADK
                     FPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCL
                     FWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQ
                     LPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYN
                     MMISAGFSLWVYKQFDTYNLWNTFTRLQSLENVAFNVVNKGHFDGQQGEVPVSIINNT
                     VYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDY
                     KRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEG
                     SVKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFK
                     PRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESP
                     FELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKV
                     TIDYTEISFMLWCKDGHVETFYPKLQSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGD
                     SATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLP
                     TGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEG
                     FFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFL
                     IGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKE
                     GQINDMILSLLSKGRLIIRENNRVVISSDVLVNN

EDIT2: Dalp, pythagore, c'est les triangle rectangle pas isocele.
Titre: Le vaccin et vous
Posté par: dalporto le mai 25, 2021, 10:27:18 pm
The sum of the square roots of any two sides of an isosceles triangle is equal to the square root of the remaining side.
Titre: Le vaccin et vous
Posté par: Cinéphile IV le mai 25, 2021, 11:28:25 pm
Tsé quand t'apprend un mot nouveau pis que tu te mets à le voir partout...

:smiley3:

Yep, un seul brin d'ARN dont le code complet est :

                     MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQ
                     HLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGE
                     TLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQEN
                     WNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQ
                     LDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFP
                     LNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQTG
                     DFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESG
                     LKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNL
                     LEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGN
                     FKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAA
                     ITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKL
                     KPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLV
                     NKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEII
                     FLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEK
                     YCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEK
                     CSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEF
                     KLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPE
                     EEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSG
                     YLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESD
                     DYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLA
                     PLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIA
                     EIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGN
                     LHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV
                     PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREM
                     LAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLIN
                     TLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSS
                     KTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVIT
                     FDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPH
                     NSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIK
                     WADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELG
                     DVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQ
                     IPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSK
                     ETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYY
                     KKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVT
                     FFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWST
                     KPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGD
                     IILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNS
                     VPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNYMPYFFTLLLQLCTFTRSTNSRI
                     KASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTA
                     ALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLET
                     IQITISSFKWDLTAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWL
                     MWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVE
                     CTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDEVARDLSLQFKRP
                     INPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPI
                     NVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVN
                     TFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVEC
                     LKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALI
                     WNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGGKIVNNWL
                     KQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFA
                     NKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLP
                     RVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLEGSVA
                     YESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSG
                     RWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL
                     AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTN
                     DVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFE
                     EAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHL
                     AKALNDFSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNG
                     LWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVL
                     KLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSC
                     GSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVN
                     VLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAV
                     LDMCASLKELLQNGMNGRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHW
                     LLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFL
                     LPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTAR
                     TVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLAR
                     GIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYL
                     VSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQSKMSDVKCTSVVL
                     LSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINKL
                     CEEMLDNRATLQAIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAK
                     SEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALN
                     NIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDA
                     DSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTA
                     CTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTP
                     KGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDAAK
                     AYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDH
                     PNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYGCSCDQLREPMLQSA
                     DAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKFLKTNCCRFQEKD
                     EDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDGDMVPHISRQR
                     LTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYA
                     NLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPGSGVPVV
                     DSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFKYWDQ
                     TYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRE
                     LGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQ
                     TVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDI
                     RQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQ
                     DALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAAT
                     RGATVVIGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLAR
                     KHTTCCSLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQ
                     AVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMM
                     ILSDDAVVCFNSTYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCS
                     QHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKH
                     PNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTV
                     LQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCD
                     VTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDW
                     TNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHLSWEVGKP
                     RPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSH
                     TVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGK
                     SHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKF
                     KVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQ
                     LPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLK
                     AHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNA
                     VASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSD
                     RDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKVITGLHPTQAPTHLSVDTKFKT
                     EGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEG
                     CHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSRVSAKPPPGDQFKHLIP
                     LMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCL
                     CDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQSNHDLYCQVHGNA
                     HVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHMVVKAALLADK
                     FPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSDKFTDGVCL
                     FWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSAFVNLKQ
                     LPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYLDAYN
                     MMISAGFSLWVYKQFDTYNLWNTFTRLQSLENVAFNVVNKGHFDGQQGEVPVSIINNT
                     VYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDY
                     KRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEG
                     SVKGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFK
                     PRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESP
                     FELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKV
                     TIDYTEISFMLWCKDGHVETFYPKLQSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGD
                     SATLPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLP
                     TGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEG
                     FFTYICGFIQQKLALGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFL
                     IGCNYLGKPREQIDGYVMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKE
                     GQINDMILSLLSKGRLIIRENNRVVISSDVLVNN

Titre: Le vaccin et vous
Posté par: MadChuck le mai 26, 2021, 12:03:06 am
Yep, un seul brin d'ARN dont le code complet est
Generalement non pour les coronavirus, je pense non ?:
Spherical or pleomorphic enveloped particles containing single-stranded (positive-sense) RNA associated with a nucleoprotein within a capsid comprised of matrix protein

Y,a un peu plus de chose autour, sars 2:
(https://ars.els-cdn.com/content/image/1-s2.0-S092544392030226X-gr1.jpg)

(https://static.scientificamerican.com/sciam/assets/Image/2020/saw0720Fisc31_d.png)
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 26, 2021, 01:25:57 pm
En voici maintenant des fibres de cotton. J'ai photoshopper 100 de tes virus sur l'image. Est-ce que tu les vois ?

NON parceque à l'échelle de ton masque de cotton, Ce virus fait 1% d'un pixel. et la fibre de cotton fait 15 pixel de large.

La fibre qui sert a faire les masque est 1000 fois plus grosse que le virus. On s'en calise qu'il y'est des spike de protein autour et une couche de lipide, le virus est a l'échelle moléculaire et le masque ne l'est pas.
Titre: Le vaccin et vous
Posté par: MadChuck le mai 26, 2021, 02:07:13 pm
La fibre qui sert a faire les masque est 1000 fois plus grosse que le virus. On s'en calise qu'il y'est des spike de protein autour et une couche de lipide, le virus est a l'échelle moléculaire et le masque ne l'est pas.

tu sembles complètement changer de sujet, mais ici echelle moléculaire est assez flou un molécule comme L'ARN ici est une macro molécule est gigantesques pour une molécules, y'a des milliers de molécules dans les spikes protéines dessinés autour qui sont a une autre échelles.

Mais la grosseur d'un virus n'a pas d'importance ici, c'est seulement la grosseur des véhicules capable de porter assez de virus en bon état pour causé un danger pour une personne qui importe:

https://www.usatoday.com/story/news/factcheck/2020/06/11/fact-check-n-95-filters-not-too-large-stop-covid-19-particles/5343537002/

Un virus est jamais nu, toujours dans de l'eau soit des gouttelettes appeler aérosole quand elles sont assez petites pour flotter longtemps qui seront elle dans les 1 micron et bien filtré par un N95-K95 bien installé (et les N95-KN95 c'est des petites masques ultra cheap a 35 cennes acheté en petite quantité sur amazon utiliser pour faire des jobs de plattre de mur la, pas des N99 couteux ou spécial qui sont encore des examples de masques qui laisse passé l'oxygéne et qui devrait être inutile selon vous)

Vous semblez avoir dit il y a quelque message que de simple N95 arrivait a réduire de 50% les infections virales en hôpital (et bien plus pour la grippe en particulier et imaginer si c'est pour des expositions pas aussi intense et pas aussi plusieurs par jours tous les jours) et vous retournez pour dire qu'ils sont parfaitement inutile maintenant ?
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 26, 2021, 04:38:06 pm
1)Oui, les mask N95 et K95 bloquent 95% de particules de .3 micron et donc plus ou moins 50% de covid.
2)L'efficacité réelle est bien plus basse, ils ne bloque pas les peau, ni les yeux, ni les truc qu'on consome et personne ne les porte 24/7 . Si le gouvernement les imposait, l'impact serait plus autour de 10% sur le Rt/R0 en fin de compte.
3) Il n'y a pas assez de masque N95 pour tout le monde. Ils doivent être changé a tout les 8 heures et ce n'est PAS ce que nous portons tous.
4) Même si ils fonctionnait à 50% pour vrai, ça aurais seulement étirer la vague d'un autre mois et le nombre de cas total n'aurait que vaguement changé.
5) Vous avez tous de la difficulté à comprendre la pandémie, si vous avez 84% de chance d'être exposé à covid, vous avez 70% d'être exposé 2 fois et 50% de chance d'être exposé 4 fois. et 25% de chance d'être exposé 8 fois. Si le masque vous protège a 25%, il a 6.25% de chance de vous protéger 2 fois de suite et 0.4% de chance de vous protéger 4 fois. Autrement dis, c'est complètement insuffisant.

Le point que j'essaie de faire depuis 2 pages, c'est qu'en enlevant son masque pour 30 seconds, wolfkiller a (en supposant qu'il change entre un N95 et un autre N95) doublé son exposition. Si on suppose qu'il est sorti 30 minutes. ça fait 1830 secondes d'exposition au lieu de 1800 secondes d'exposition. Il avait probablement plus de risque de se fouler une cheville en décendant de son char et mourir de gangrenne, qu'il en a pris en switchant de masque.
Titre: Le vaccin et vous
Posté par: MadChuck le mai 26, 2021, 05:06:08 pm
2)L'efficacité réelle est bien plus basse, ils ne bloque pas les peau, ni les yeux, ni les truc qu'on consome et personne ne les porte 24/7 . Si le gouvernement les imposait, l'impact serait plus autour de 10% sur le Rt/R0 en fin de compte.

On est parti d'une étude du monde réel et non théorique qui montre une diminution de 66% chez les travailleurs hospitalier a attrapé la grippe en portant un simple masque a 30 cenne cependant, je me demande pourquoi ce serait différent pour COVID tant que ça.

3) Il n'y a pas assez de masque N95 pour tout le monde. Ils doivent être changé a tout les 8 heures et ce n'est PAS ce que nous portons tous.

L'origine de la discussion était que si l'oxygène passe par définition le masque est inutile a réduire d'aucune façon significatif le risque, si vous vouliez dire a la place, les masques maisons ou ceux avec des fleur dessinés dessus ne sont pas significativement efficace a protéger son porteur et seulement si on chanceux aide a protéger les autres si le porteur du masque est contagieux, c'est un autre sujet.

4) Même si ils fonctionnait à 50% pour vrai, ça aurais seulement étirer la vague d'un autre mois et le nombre de cas total n'aurait que vaguement changé.

Si le R0 est dans les 3.x au minium selon vous, si on a un RT de 1.6 au lieu de 3.2 avec cette seule mesure et un autre 15% avec toutes les autres pour un de 1.36 en utilisant cette calculatrice:

https://gabgoh.github.io/COVID/index.html

Avec un RT de 3.2, 86 jours après qu'on ai 100 infection 95% des personnes en contact possible avec la maladie la attrapé et .

Avec RT de 1.36 après 200 jours 13% de la population en contact possible avec la maladie la attrapé et l'immunité collective avec un RT aussi bas devrait arrivé dans les 5x% au lieu des 9x%, tous dépendent des niveaux de résistances naturelles encore méconnu dans la population.

Citer
5) Vous avez tous de la difficulté à comprendre la pandémie, si vous avez 84% de chance d'être exposé à covid, vous avez 70% d'être exposé 2 fois et 50% de chance d'être exposé 4 fois. et 25% de chance d'être exposé 8 fois. Si le masque vous protège a 25%, il a 6.25% de chance de vous protéger 2 fois de suite et 0.4% de chance de vous protéger 4 fois. Autrement dis, c'est complètement insuffisant.

Vous venez de bien expliquer pourquoi un masque qui diminuerait de 90% les chances d'attrapé le virus respiratoire une journée normale avec une exposition basse pourrait sur une longue période sembler n'être efficace qu'a 25-50-60% pour ceux qui sont super exposé 8 heures par jours dans un hôpital.

Citer
Le point que j'essaie de faire depuis 2 pages, c'est qu'en enlevant son masque pour 30 seconds, wolfkiller a (en supposant qu'il change entre un N95 et un autre N95) doublé son exposition. Si on suppose qu'il est sorti 30 minutes. ça fait 1830 secondes d'exposition au lieu de 1800 secondes d'exposition. Il avait probablement plus de risque de se fouler une cheville en décendant de son char et mourir de gangrenne, qu'il en a pris en switchant de masque.

Oui ça semble me faire sense (C,est peut-être bien 10 seconde pour chaque s cependant, le chiffre nous ai pas bien connu), ce n'est pas du tout le point que vous avez essayer de faire, vous n'avez pas dit dans un endroit a grand volume un petit moment donne pas grand chance d'entrer en contact avec un gros volume de virus en bon état pour être dangereux, masqué ou pa, mais que ceux-ci savent par définition a rien en utilisant le fait que si des mini molecules de 02 de 2 atomes passe, une géante macro molécule de centaines de millions d'atomes entourer de protéines et de graisses qui doit voyager dans une super petite micro goutelle en aérosol va aussi passer par votre masque. Surtout si vous la personne avait le genre de masque avec les gros trous sur les côtés et non pas du style n95 bien ajusté, le tamtrum était mal comprendre les formules de risque ici.
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 27, 2021, 06:13:22 pm
3) Il n'y a pas assez de masque N95 pour tout le monde. Ils doivent être changé a tout les 8 heures et ce n'est PAS ce que nous portons tous.

L'origine de la discussion était que si l'oxygène passe par définition le masque est inutile a réduire d'aucune façon significatif le risque, si vous vouliez dire a la place, les masques maisons ou ceux avec des fleur dessinés dessus ne sont pas significativement efficace a protéger son porteur et seulement si on chanceux aide a protéger les autres si le porteur du masque est contagieux, c'est un autre sujet.
Je spécifie alors:
À moins d'avoirs une filtration certifiée (et encore), si vous parvenez à respirer vous êtes fort probablement exposé à covid-19.
Si le R0 est dans les 3.x au minium selon vous, si on a un RT de 1.6 au lieu de 3.2 avec cette seule mesure et un autre 15% avec toutes les autres pour un de 1.36 en utilisant cette calculatrice:

https://gabgoh.github.io/COVID/index.html

Avec un RT de 3.2, 86 jours après qu'on ai 100 infection 95% des personnes en contact possible avec la maladie la attrapé et .

Avec RT de 1.36 après 200 jours 13% de la population en contact possible avec la maladie la attrapé et l'immunité collective avec un RT aussi bas devrait arrivé dans les 5x% au lieu des 9x%, tous dépendent des niveaux de résistances naturelles encore méconnu dans la population.
Faut être une espèce particulière d'attardé pour regarder le graph à 1.36 Rt et pas se rendre compte que la vague culmine autour du jour 300. Donc l'argument "après 200 jours" est particulièrement de mauvaise foi.

Oui ça semble me faire sense (C,est peut-être bien 10 seconde pour chaque s cependant, le chiffre nous ai pas bien connu)
Tu viens juste de donner une étude qui dis que c'est au mieux(N95) 50% . 50% de 2 seconde, ça fait bien une seconde. mais c'est peut-être trop compliqué pour ton niveau...
Titre: Le vaccin et vous
Posté par: Lisa le mai 27, 2021, 08:22:33 pm
Ilu: Prend rdv le 11 au stade, ça va me faire plaisir de te vacciner.
Titre: Le vaccin et vous
Posté par: Ring0 le mai 27, 2021, 09:10:47 pm
As-tu loué le stade ?
Titre: Le vaccin et vous
Posté par: Lisa le mai 27, 2021, 09:37:48 pm
Je fais mon service à la nation!
Titre: Le vaccin et vous
Posté par: dalporto le mai 27, 2021, 10:32:02 pm
Es-tu un trou d'cul?
Titre: Le vaccin et vous
Posté par: Ring0 le mai 28, 2021, 10:57:21 am
Es-tu un trou d'cul?

Non mais j'ai de l'argent.
Titre: Le vaccin et vous
Posté par: dalporto le mai 28, 2021, 11:20:25 am
Ça prend les deux.
Titre: Le vaccin et vous
Posté par: MadChuck le mai 28, 2021, 12:46:00 pm
Assez bonne nouvelle:

https://www.nytimes.com/2021/05/26/health/coronavirus-immunity-vaccines.html
Immunity to the coronavirus lasts at least a year, possibly a lifetime, improving over time especially after vaccination, according to two new studies.
“The papers are consistent with the growing body of literature that suggests that immunity elicited by infection and vaccination for SARS-CoV-2 appears to be long-lived,” said Scott Hensley, an immunologist at the University of Pennsylvania who was not involved in the research.

In fact, memory B cells produced in response to infection with SARS-CoV-2 and enhanced with vaccination are so potent that they thwart even variants of the virus, negating the need for boosters, according to Michel Nussenzweig, an immunologist at Rockefeller University in New York who led the study on memory maturation.


https://www.biorxiv.org/content/10.1101/2021.05.07.443175v1.abstract
https://www.nature.com/articles/s41586-021-03647-4
Cells that retain a memory of the virus persist in the bone marrow and may churn out antibodies whenever needed

De ce que j'en comprend la diminution des anticorps dans un test de sang dans le temps était trompeur, la moelle épinière a construit des cellulaires mémoire qui serait capable d'en refaire en cas d'infection au besoin et potentiellement pour le reste de la vie.
Titre: Le vaccin et vous
Posté par: MadChuck le mai 28, 2021, 12:51:33 pm
Faut être une espèce particulière d'attardé pour regarder le graph à 1.36 Rt et pas se rendre compte que la vague culmine autour du jour 300. Donc l'argument "après 200 jours" est particulièrement de mauvaise foi.

C'est très impolie monsieur, vous n'avez qu'à changer le nombre d'infecter au départ pour savoir comment ca se joue au complet, chose que j'ai fait pour obtenir le chiffre 50% d'infecté (D'ou pensez vous qu'il provient si apres 200 jours il n'y a que 13% d'infecté?), les 2 informations sont très bien la et présenté, et si nos été écrase COVID au Québec, l'information après 150-200 jours est très pertinente parce que c'est la duré maximal avec R0 au dessus de 1 avec nos mesures.

Tu viens juste de donner une étude qui dis que c'est au mieux(N95) 50% . 50% de 2 seconde, ça fait bien une seconde. mais c'est peut-être trop compliqué pour ton niveau...
1) C'était 66% pour la grippe
2) Bien voyons vous veniez bien de dire que :
Vous avez tous de la difficulté à comprendre la pandémie, si vous avez 84% de chance d'être exposé à covid, vous avez 70% d'être exposé 2 fois et 50% de chance d'être exposé 4 fois. et 25% de chance d'être exposé 8 fois. Si le masque vous protège a 25%, il a 6.25% de chance de vous protéger 2 fois de suite et 0.4% de chance de vous protéger 4 fois. Autrement dis, c'est complètement insuffisant.

Un masque qui réduit tes chances de 90% par 20 secondes de respiration, ne va pas nécessairement mené a 90% moins d'infection sur une période de 4 semaine selon cette logique je pense.
Titre: Le vaccin et vous
Posté par: Iluvalar le mai 28, 2021, 03:15:29 pm
COVID au Québec, l'information après 150-200 jours est très pertinente parce que c'est la duré maximal avec R0 au dessus de 1 avec nos mesures.
On est joliement proche de faire 1+1 ici. Si le R0 avait été même vaguement proche de 1.3 avec nos mesure, la vague aurait mis 300 jours a culminer. Or, ont vois clairement avec les données qu'elle a passé complètement en 150 jours. Le R0 avec mesures était toujours au dessus de 2.

Un masque qui réduit tes chances de 90% par 20 secondes de respiration, ne va pas nécessairement mené a 90% moins d'infection sur une période de 4 semaine selon cette logique je pense.
oui donc, les masque N95(que personne n'utilise a l'extérieur de l'hopital) réduisent de 50% l'inhalation de covid-19. J'insiste pour préciser qu'ils n'ont pas d'impact sur les autres risque d'infections. Peau, yeux, ce qu'on consomme... Donc l'impact final des masques N95 (que personne ne portent) est bien inférieur à 50%.

Mais quand bien même ils le serait à 50%, ça voudrait dire qu'une seconde sans masque, en vaudrait 2 avec masque. Pas 3, pas 5 pas 10 secondes. AU MAXIMUM.

Disons qu'on avait 0.000002% de chance d'attraper covid a toute les secondes, l'efficacité du masque réel diminuerait d'autant à toute les secondes. Donc, si je ne m'abuse, les masques auraientt perdu 2% d'efficacité par jour. pour être efficace à seulement 7% de 50% après 150 jours d'exposition.
Titre: Le vaccin et vous
Posté par: El Kabong le mai 30, 2021, 04:09:42 pm
Zéro vaccin et tout va bien!

J'avoue que l'utilisation du masque, même cheap, m'a bien servi.  J'ai évité les postillons innombrables des cochons ambulants qui parlent en vous crachant dans la face:  Zéro grippe et zéro rhume cet hiver.

C'était la solution la plus facile et celle qui nous manquait il y a quinze mois, merci au docteur d'avoir prétendu le contraire.

J'avais suggéré au peuple de visionner le docu "HOLD-UP" qui laisse le crachoir aux scientifiques établis qui osent contredire le discours ambiant.  Zéro commentaire. Même Illuvatar n'a pas l'air de l'avoir vu!

Ceci dit, la science est une chose et les intellox corrompus qui la pervertissent en est une autre.  Pensez aux cochons de Santé Canada qui avaient interdit la citronnelle tout en permettant le DEET.  La molécule contient un cycle benzénique, en clair, ce devrait être considéré comme cancérigène.  Mais pour les multinationales et leurs suppôts, rien n'est cancérigène. 

Ouache.
Titre: Le vaccin et vous
Posté par: MadChuck le mai 30, 2021, 10:22:10 pm
On est joliement proche de faire 1+1 ici. Si le R0 avait été même vaguement proche de 1.3 avec nos mesure, la vague aurait mis 300 jours a culminer. Or, ont vois clairement avec les données qu'elle a passé complètement en 150 jours. Le R0 avec mesures était toujours au dessus de 2.

Mais c'est un autre sujet complètement, ce qui était discuté était si les masques réduirait le RT de 50% cela serait inutile ou pas et non pas quel est le R0 (ont parlait aucunement du R0 ici).

oui donc, les masque N95(que personne n'utilise a l'extérieur de l'hopital) réduisent de 50% l'inhalation de covid-19. J'insiste pour préciser qu'ils n'ont pas d'impact sur les autres risque d'infections. Peau, yeux, ce qu'on consomme... Donc l'impact final des masques N95 (que personne ne portent) est bien inférieur à 50%.

Mais quand bien même ils le serait à 50%, ça voudrait dire qu'une seconde sans masque, en vaudrait 2 avec masque. Pas 3, pas 5 pas 10 secondes. AU MAXIMUM.

Le 65% moins de grippe avec le port du masque dans l'étude, n'exclut pas les infections avec les yeux et compagnie, vous parlez de masques que l'on voit un peu partout et qui se vendent aux costco:
https://www.costco.ca/kn95-disposable-5-layer-face-mask%2C-20-pack.product.100672009.html

Ou dans les Rona depuis toujours pour faire de la rénovation:
https://www.rona.ca/en/tools/clothing-and-safety/masks

Et non pas de masque spécial portez simplement en hôpital et peut importe n'importe quel masque qui laisse passé des molécules d'oxygène de l'extérieur fonctionnerait pour les bien de la discussion on aurait pu prendre les n99 avec un hazmat suit complèt, tant qu'il n'y pas sa propre bonbomne d'air.

Vous semblez complètement dévié de cette logique exprimé il n'y a que quelque message:
Vous avez tous de la difficulté à comprendre la pandémie, si vous avez 84% de chance d'être exposé à covid, vous avez 70% d'être exposé 2 fois et 50% de chance d'être exposé 4 fois. et 25% de chance d'être exposé 8 fois. Si le masque vous protège a 25%, il a 6.25% de chance de vous protéger 2 fois de suite et 0.4% de chance de vous protéger 4 fois. Autrement dis, c'est complètement insuffisant.


POur que le masque nous protège de la grippe par 65% pendant 4 semaines de 8 heures de travail, selon cette logique il doit a chaque 10 secondes d'exposition nous protégé de bien plus de 65%, non ?


Disons qu'on avait 0.000002% de chance d'attraper covid a toute les secondes, l'efficacité du masque réel diminuerait d'autant à toute les secondes. Donc, si je ne m'abuse, les masques auraientt perdu 2% d'efficacité par jour. pour être efficace à seulement 7% de 50% après 150 jours d'exposition.

Exactement je pense qu'on dit la meme chose, alors pour être efficace a seulement 65% après 28 jours contre la grippe, il est peut-être bien efficace a 95% pendant une minute, mais après chaque 8 heure, chaque jours dans un environnement toujours ultra contagieux de l'hopital, apres 28 jours il sera moins efficace. Vous semblez encore répéter exactement et vous contredire dans le même message. Une personne normale ne sera pas exposer comme un travailleur d'hôpital, ça peut-etre efficace a seulement 50%-65% 4 semaines a passer 9-10 heures dans un hôpital, mais l'être plus pendant 200 jours avec peu d'exposition.
Titre: Le vaccin et vous
Posté par: Cinéphile IV le mai 31, 2021, 10:46:29 am
Je suis loin de lire tout ce que vous écrivez ici, et je ne suis certainement pas le seul, mais après 356 messages, vous devriez tous deux imprimer cette phrase et la faire encadrer chez chez vous :

Exactement je pense qu'on dit la même chose
Titre: Le vaccin et vous
Posté par: Gilbert Du Motier le mai 31, 2021, 04:21:16 pm
Piqué drette sur la batte!
Titre: Le vaccin et vous
Posté par: Le Jam le juin 02, 2021, 01:33:58 pm
Tu t'es fait vacciné sur le pénis ?

Pervers !
Titre: Le vaccin et vous
Posté par: cantabile le juin 02, 2021, 02:35:06 pm
Ça va être joyeux la vaccination des élèves....
Titre: Le vaccin et vous
Posté par: Ring0 le juin 02, 2021, 02:48:46 pm
Tu t'es fait vacciné sur le pénis ?

Pervers !

Non c'est un terme de baseball. Ça veut dire qu'il s'est fait vacciner au Stade olympique.
Titre: Le vaccin et vous
Posté par: Berslak le juin 02, 2021, 04:29:54 pm
Tu t'es fait vacciné sur le pénis ?

Pervers !

Non c'est un terme de baseball. Ça veut dire qu'il s'est fait vacciner au Stade olympique.

Merci. J'aurais jamais deviné!
Titre: Le vaccin et vous
Posté par: Lisa le juin 25, 2021, 11:31:29 am
Je vaccine a côté du chum de Wolfkiller toute la journée!!
Titre: Le vaccin et vous
Posté par: dalporto le juin 25, 2021, 11:32:41 am
Gayyyyyyyyyyyyyy.
Titre: Le vaccin et vous
Posté par: cantabile le juin 25, 2021, 06:49:55 pm
Je vaccine a côté du chum de Wolfkiller toute la journée!!
donc tu es payée par le Centre.de services.pour être payée par le réseau de la santé ? Eh ben..
Titre: Le vaccin et vous
Posté par: Lisa le juin 25, 2021, 07:33:00 pm
Je vaccine a côté du chum de Wolfkiller toute la journée!!
donc tu es payée par le Centre.de services.pour être payée par le réseau de la santé ? Eh ben..

J'aime ça que ce soit ton premier réflexe...

Juste parce que je suis fine pis que je monte pas sur mes grands chevaux quand je me fais traiter de fraudeuse à mots couverts, je te réponds pareil:
Je ne travaille pas à temps plein dans le réseau de l'éducation. Nous avons eu la consigne de vacciner seulement sur notre propre temps (donc durant nos journées de congé, ou même le soir et la fin de semaine). On est malgré tout une dizaine d'orthophonistes du Centre de services scolaires à donner de notre temps en plus de notre pleine prestation de travail.

Voilà, ne t'inquiète pas pour tes taxes. ;)
Titre: Le vaccin et vous
Posté par: cantabile le juin 25, 2021, 09:16:20 pm
J'ai jamais pensé à une fraude...je trouvais juste ça particulier de faire 2 jobs en même temps. Désolé pour mon intervention qui était sans doute un brin inadéquate.
Titre: Le vaccin et vous
Posté par: Lisa le juin 25, 2021, 09:20:00 pm
Merci. Je suis heureuse de le lire.

J'avoue que je vais faire des plus grosses semaines cet été que durant l'année! Je stresse un peu ! Ben des lunchs en perspective!
Titre: Le vaccin et vous
Posté par: sharl le juin 26, 2021, 03:28:48 pm
J'ai jamais pensé à une fraude...je trouvais juste ça particulier de faire 2 jobs en même temps. 

Une personne vaillante,,, Elle!

"On est malgré tout une dizaine d'orthophonistes du Centre de services scolaires à donner de notre temps en plus de notre pleine prestation de travail."

Cela dit, ça me surprend de voir les orthophonistes dans la vaccination,,,
Titre: Le vaccin et vous
Posté par: cantabile le juin 26, 2021, 06:43:15 pm
Sacré Sharl !
Titre: Le vaccin et vous
Posté par: Lisa le juin 27, 2021, 04:11:14 pm
J'ai jamais pensé à une fraude...je trouvais juste ça particulier de faire 2 jobs en même temps. 

Une personne vaillante,,, Elle!

"On est malgré tout une dizaine d'orthophonistes du Centre de services scolaires à donner de notre temps en plus de notre pleine prestation de travail."

Cela dit, ça me surprend de voir les orthophonistes dans la vaccination,,,

Nous sommes, cela peut être surprenant, issue de la faculté de médecine de différentes universités. Nous sommes de plus soumis à des codes d'éthiques de nos différents ordres professionnels.
Et comme les ergothérapeutes, physiothérapeutes, acupuncteurs, nous avons fait l'objet d'un décret pour pouvoir être injecteur pour la vaccination.

(Nous avions préalablement le décret pour pouvoir faire des dépistages COVID également).

https://www.msss.gouv.qc.ca/ministere/salle-de-presse/communique-2488/
Titre: Le vaccin et vous
Posté par: sharl le juin 28, 2021, 03:35:23 pm
J'espère qu'on vous a quand même donné un p'tit cours sur l'art de vacciner sans faire mal,,,
Titre: Le vaccin et vous
Posté par: Lisa le juin 28, 2021, 07:06:36 pm
Oui, formations en ligne, formation en salle, et stage pratique.

J'ai été stressée pour les premières mais j'avais vraiment une "marraine" de feu, une physio de Ste-Justine qui m'a super bien expliqué les petits détails qui font la différence et le pourquoi du comment (que j'adore comprendre).

À date, la plupart des gens me disent qu'ils n'ont rien senti et que je fais ça très bien :)
Titre: Le vaccin et vous
Posté par: sharl le juin 28, 2021, 09:19:54 pm
À date, la plupart des gens me disent qu'ils n'ont rien senti et que je fais ça très bien :)

 :smiley20:
Titre: Le vaccin et vous
Posté par: Cinéphile IV le juin 28, 2021, 10:32:08 pm
Oui, formations en ligne, formation en salle, et stage pratique.

Genre 2-3 conseils, une couple de serviettes, pis un bol d'eau chaude? :smiley2:

EDIT : Oups, je me suis trompé de fil de discussion...
Titre: Le vaccin et vous
Posté par: Iluvalar le juin 28, 2021, 11:22:36 pm
Citation de: Organisation Mondiale de la Santé (https://www.who.int/fr/emergencies/diseases/novel-coronavirus-2019/covid-19-vaccines/advice?fbclid=IwAR2ucapHIhh-VMzgJ5gOiEoPpRj7uA1P6cL9VHrxmhnV3yXDqxVvKDwQCZs)
à moins qu’ils ne fassent partie d’un groupe pour lequel le risque de contracter une forme sévère de la maladie est plus élevé [...]
Nous avons besoin de davantage de données sur l’utilisation des différents vaccins contre la COVID-19 chez les enfants afin de pouvoir formuler des recommandations générales sur la vaccination des enfants contre la COVID-19.
Attention, je suis un dangereux "négationniste sanitaire" je cite l'OMS !
Titre: Le vaccin et vous
Posté par: Snookey le juin 29, 2021, 08:32:04 am
T'es pas un enfant. T'es tu finalement fait piquer ou t'as encore trop peur ?
Titre: Le vaccin et vous
Posté par: cibiou le juin 29, 2021, 04:45:33 pm
Double vaccinée - ça, c'est fait
8 minutes entre le moment de l'arrivée et la piqûre elle-même : le centre était tout à fait vide...
Titre: Le vaccin et vous
Posté par: Snookey le juin 29, 2021, 04:49:30 pm
Double vaccinée - ça, c'est fait
8 minutes entre le moment de l'arrivée et la piqûre elle-même : le centre était tout à fait vide...

Où ça?!
Titre: Le vaccin et vous
Posté par: dalporto le juin 29, 2021, 05:02:59 pm
Au stade.
Titre: Le vaccin et vous
Posté par: Lisa le juillet 07, 2021, 04:25:29 pm
Les cas récents de coronavirus en Ontario:
Moore: of recent COVID-19 cases
83.2% were entirely unvaccinated
15.6% partially vaccinated
1.2% fully vaccinated

https://twitter.com/jm_mcgrath/status/1412490096247558144
Titre: Le vaccin et vous
Posté par: Snookey le juillet 07, 2021, 04:40:13 pm
2ème dose à l'aréna Martin Brodeur hier, il n'y avait pas foule ! 5 minutes in-salle d'attente.
Titre: Le vaccin et vous
Posté par: dalporto le juillet 07, 2021, 10:10:32 pm
Je suis allé là à matin, pas attendu longtemps non plus.
Titre: Le vaccin et vous
Posté par: plsavaria le juillet 07, 2021, 10:22:11 pm
La soeur non vaccinée (anti vaxx) d'une amie, toute outrée de ne pas pouvoir visiter son père en soins intensifs, sortant d'une opération à coeur ouvert.
Alors que la soeur vaccinée peut y aller...
Injustice!
Et tant mieux, ces bâtons dans les roues vont peut être pousser quelques % supplémentaires à se faire vacciner à moyen terme.
Titre: Le vaccin et vous
Posté par: dalporto le juillet 07, 2021, 10:23:49 pm
https://twitter.com/i/status/1412795178734215168
Titre: Le vaccin et vous
Posté par: Iluvalar le juillet 08, 2021, 06:02:06 pm
twitter
Juste sur la fin "ceux qui ont un comportement le plus a risque". Logique fautive après 12 mois. Les gens les plus a risque l'ont probablemen déjà eu. Ce sont les moins probable à être encore virulent dans le milieu de l'été. Seulement les gens qui ont éviter covid-19 jusqu'ici peuvent le transmettre.
Titre: Le vaccin et vous
Posté par: dalporto le juillet 08, 2021, 06:31:04 pm
Arrête, tu te cales.
Titre: Le vaccin et vous
Posté par: Lisa le juillet 08, 2021, 08:54:57 pm
"Blood samples from just 10 percent of people immunized with one dose of the AstraZeneca or the Pfizer-BioNTech vaccines were able to neutralize the Delta and Beta variants. But a second dose boosted that number to 95 percent."
https://www.nytimes.com/2021/07/08/health/delta-variant-covid-vaccine-immunity.html
Titre: Le vaccin et vous
Posté par: MadChuck le juillet 09, 2021, 03:16:23 pm
twitter
Juste sur la fin "ceux qui ont un comportement le plus a risque". Logique fautive après 12 mois. Les gens les plus a risque l'ont probablemen déjà eu. Ce sont les moins probable à être encore virulent dans le milieu de l'été. Seulement les gens qui ont éviter covid-19 jusqu'ici peuvent le transmettre.

Content de voir que tu es maintenant un peu plus positif sur la durée d'immunité produite par une infection (et j'imagine le vaccin).

Je me demande aussi si la logique est pas un peu fautive, probablement vrai avant que le vaccin soit largement disponible, mais ont-ils un comportement plus a risque que les gens vaccinés aujourd'hui ?
Titre: Le vaccin et vous
Posté par: Cinéphile IV le juillet 09, 2021, 03:56:29 pm
"Blood samples from just 10 percent of people immunized with one dose of the AstraZeneca or the Pfizer-BioNTech vaccines were able to neutralize the Delta and Beta variants. But a second dose boosted that number to 95 percent."
https://www.nytimes.com/2021/07/08/health/delta-variant-covid-vaccine-immunity.html

Rassurant, merci Lisa. Deuxième dose le 27 août, je suis all in AstroZeneco.

Astro le petit vaccin

(https://lh3.googleusercontent.com/proxy/4xyUGMsmOe7ZXhQGeeMoMjH013R4JvfHvYgjfwH0SJItSWsZz3KYS3hjhqEw3OYiwPQ9Ofn1DJdqxmA82gVEm11fs_McmUvmdo70mD36Wg)
Titre: Le vaccin et vous
Posté par: Lisa le juillet 09, 2021, 06:20:17 pm
"Blood samples from just 10 percent of people immunized with one dose of the AstraZeneca or the Pfizer-BioNTech vaccines were able to neutralize the Delta and Beta variants. But a second dose boosted that number to 95 percent."
https://www.nytimes.com/2021/07/08/health/delta-variant-covid-vaccine-immunity.html

Rassurant, merci Lisa. Deuxième dose le 27 août, je suis all in AstroZeneco.

Astro le petit vaccin

(https://lh3.googleusercontent.com/proxy/4xyUGMsmOe7ZXhQGeeMoMjH013R4JvfHvYgjfwH0SJItSWsZz3KYS3hjhqEw3OYiwPQ9Ofn1DJdqxmA82gVEm11fs_McmUvmdo70mD36Wg)

Si tu comptes voyager aux États-Unis, je te conseille de demander Pfizer ou Moderna en deuxième dose. D'ailleurs, les centres de vaccination essaie de convaincre les gens de changer pour la 2e dose. C'est aussi ce qui est plus recommandé. Les USA ne reconnaissent pas le AZ comme valide.

Je te conseille aussi de devancer ta 2e dose, cela me semble tard. Minimum 28 jours, recommandé 8 semaines.
Titre: Le vaccin et vous
Posté par: Cinéphile IV le juillet 09, 2021, 08:43:31 pm
Si tu comptes voyager aux États-Unis, je te conseille de demander Pfizer ou Moderna en deuxième dose. D'ailleurs, les centres de vaccination essaie de convaincre les gens de changer pour la 2e dose. C'est aussi ce qui est plus recommandé.

J'avais lu que la deuxième dose fessait moins si on reprenait le même. :smiley18:

Les USA ne reconnaissent pas le AZ comme valide.

:smiley22:

Je te conseille aussi de devancer ta 2e dose, cela me semble tard. Minimum 28 jours, recommandé 8 semaines.

Je l'ai déjà devancé, j'avais le 17 août au départ.

Mais bon UN GROS merci, je vais assurément regarder ça.
Titre: Le vaccin et vous
Posté par: Cinéphile IV le juillet 09, 2021, 09:31:26 pm
AstraZeneca: pas de problème pour voyager ou pour des activités, assure François Legault

https://www.lesoleil.com/actualite/covid-19/astrazeneca-pas-de-probleme-pour-voyager-ou-pour-des-activites-assure-francois-legault-350d39328237acb99ed12a3c8f660a17?page=1&q=AstraZeneca%20voyager&size=50&sort=score

Qu’ils soient vaccinés avec une dose d’AstraZeneca ou qu’ils aient reçu un mélange de deux vaccins, les Québécois ne rencontreront pas de difficultés à voyager, assure le premier ministre Legault.

Les interrogations fusent de toutes parts pour les vaccinés avec AstraZeneca depuis quelques jours. Si une chose est claire, c’est que les Québécois qui ont reçu ce vaccin n’auront pas de problème à prendre un vol international pour quitter le pays, a tenu à rassurer François Legault, en marge d’une conférence de presse, vendredi.

(...)

Qu’importe que les vaccinés avec AstraZeneca aient reçu deux doses du même vaccin ou pas, ils ne seront pas non plus pénalisés pour prendre part à certaines activités. Aux États-Unis, des salles de spectacles américaines empêchent notamment l’accès aux résidents vaccinés avec ce sérum.


Je ne sais pas si tu as autre chose comme source.

Y a une différence entre des salles de spectacles américaines et les USA au complet, mais aussi bien pas prendre de chances.
Titre: Le vaccin et vous
Posté par: Iluvalar le juillet 09, 2021, 10:02:18 pm
Y a une différence entre des salles de spectacles américaines et les USA au complet, mais aussi bien pas prendre de chances.
Ça dépend beaucoup des États, en Floride demandé un passerport vaccinal est illégal alors qu'en contraste les grand rassemblement à New-york sont obligés de le demandé. Si ma mémoire est bonne. Donc c'est vraiment états par états qu'il faut vérifier.
Titre: Le vaccin et vous
Posté par: Cinéphile IV le juillet 14, 2021, 10:15:04 am
AstraZeneca

Le lendemain matin en me levant je me sentais comme Rocky au lendemain de son combat contre Drago. Rendu à 10h j'étais en plein forme.

Moderna

Je me sens comme Rocky au lendemain de son premier combat contre Appolo. Il est rendu 10h et la forme revient (soulignons que je l'ai reçu plus tard dans la journée que l'AstraZeneca, alors ça se peut que ça s'étire un peu plus).
Titre: Le vaccin et vous
Posté par: El Kabong le juillet 15, 2021, 08:17:08 pm
La ségrégation (https://www.agoravox.fr/tribune-libre/article/salauds-de-non-vaccines-234356) sanitaire est en marche!
Titre: Le vaccin et vous
Posté par: dalporto le juillet 16, 2021, 09:31:50 pm
Le vaccin m'a donné un bouton sur le pénis, mais là il est parti.
Titre: Le vaccin et vous
Posté par: Ring0 le juillet 17, 2021, 03:03:20 pm
Le bouton ou le pénis ?  :smiley3:
Titre: Le vaccin et vous
Posté par: dalporto le juillet 18, 2021, 01:02:49 pm
Seulement mon péni.